(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBL

AP010958.YBBL        Location/Qualifiers
FT   CDS_pept        524407..525084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECO103_0466"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29334"
FT                   /db_xref="GOA:C8U2H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2H6"
FT                   /protein_id="BAI29334.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     atgcaggaaa atagtccttt gcttcagcta caaaacgtag gatatctggc gggtgatgcg        60
     aagattctta ataacatcaa tttttcgctg cgtgctggcg aatttaagtt aattaccggt       120
     ccttccggtt gtggcaaaag tacgctgcta aaaatagttg cttcattgat cagcccaacc       180
     agcggaacgt tactgtttga aggtgaggat gtcagcacac taaagccaga aatctaccgc       240
     cagcaagtct cttactgcgc ccagacgccg acgctgtttg gcgatacggt atacgataat       300
     ctgatctttc cctggcagat ccgtaaccag cagcctgacc cggccatttt tctcgatttt       360
     ctcgaacgct tcgctttgcc ggacagcatt ttgacgaaaa atatcgccga gctatctggt       420
     ggtgaaaaac aacgcatctc actgattcgt aacctgcaat ttatgccgaa ggttttattg       480
     ctggatgaaa tcaccagtgc gctggatgaa agtaataaac ataacgttaa tgagatgatc       540
     catcgttatg tgcgcgagca aaatattgcc gtgctgtggg tgacacacga taaagacgaa       600
     attaatcatg cggataaagt gattacactg caaccgcatg ccggagaaat gcaggaagca       660
     cgctatgaac tcgcataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page