(data stored in ACNUC10821 zone)

EMBL: AP010958.YBCF

AP010958.YBCF        Location/Qualifiers
FT   CDS_pept        557633..558526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECO103_0493"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29360"
FT                   /db_xref="GOA:C8U2K2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2K2"
FT                   /protein_id="BAI29360.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVDPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQKALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKAYGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     atgaaaacac tggttgtagc tcttgggggc aacgccttac tccagcgcgg tgaggcgctg        60
     acggcagaaa atcaatatcg caatatcgcc agtgctgtac ccgcgctggc gcgcctggcc       120
     cgttcttatc ggctggcgat tgttcacggc aatgggccgc aggtggggct gctggcattg       180
     cagaatctgg cgtggaaaga ggtagatccg tatccgctgg atgtgctggt ggcggaaagc       240
     caggggatga ttggctatat gctggcgcag agtttgagcg cacagccgca gatgccgcct       300
     gtcacgacgg tgctgacgcg cattgaggtt tcgcctgatg atccggcgtt tttgcagcca       360
     gagaaattta ttggtccggt ttatcagcca gaagaacaaa aggcactgga agcggcttac       420
     ggctggcaga tgaaacgtga tggtaaatat ttgcgccggg tggtggcgtc tccgcaaccg       480
     cgtaaaattc tcgacagcga agccatcgag ttgttgctca aagaggggca tgtggtgatt       540
     tgcagtggcg gcggcggtgt gcctgtgacg gaagatgggg cagggagtga agcggtgatt       600
     gataaagatc tcgccgctgc gttgctcgcc gagcagatta atgccgatgg actggtgatc       660
     ctcaccgatg ctgacgcggt ttatgaaaac tggggaacgc cgcagcaacg cgccattcgc       720
     catgccacac cggatgagtt agcgccattt gccaaagcct atggttcgat ggggccgaag       780
     gtaacggcgg taagtggtta tgtcagaagc cgtggtaaac ccgcgtggat tggggcgtta       840
     tcgcgaattg aagagacgct ggcgggcgaa gcggggacct gtatttcgct gtag             894
//

If you have problems or comments...

PBIL Back to PBIL home page