(data stored in SCRATCH zone)

EMBL: AP010958.YBCJ

AP010958.YBCJ        Location/Qualifiers
FT   CDS_pept        complement(563797..564009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECO103_0500"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29367"
FT                   /db_xref="GOA:C8U2K9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2K9"
FT                   /protein_id="BAI29367.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     atggcgacat tttctttagg taaacatccg cacgttgagc tgtgcgactt gctgaaactg        60
     gaaggctgga gcgaaagcgg cgcgcaggcg aaaatcgcga ttgccgaagg ccaggtgaaa       120
     gtcgacggtg cggttgaaac gcgcaaacgc tgcaaaatcg tcgccggtca gacagtgagt       180
     tttgcaggtc acagcgtaca ggttgttgcc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page