(data stored in ACNUC10821 zone)

EMBL: AP010958.YBDJ

AP010958.YBDJ        Location/Qualifiers
FT   CDS_pept        complement(644600..644848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECO103_0585"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29449"
FT                   /db_xref="GOA:C8U2U1"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2U1"
FT                   /protein_id="BAI29449.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTMFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     atgaaacacc ctttagaaac cttgactacc gcagcaggca ttttgctgat ggctttcctc        60
     tcttgcctgc tgctgcccgc ccccgcactg gggctgacgc tggcacaaaa actggtgacc       120
     atgttccatc tgatggatct tagccagctt tacactttat tgttttgtct gtggttttta       180
     gtgctgggcg ctattgagta ttttgttctg cgctttatct ggcgacgctg gttctcgctg       240
     gcggattaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page