(data stored in ACNUC10821 zone)

EMBL: AP010958.YBDZ

AP010958.YBDZ        Location/Qualifiers
FT   CDS_pept        651734..651952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECO103_0593"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29457"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2U9"
FT                   /protein_id="BAI29457.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QASCQQWLEVHWRTLTPANFTQLQEAQ"
     atggcattca gtaatccctt cgatgatccg cagggagcgt tttacatttt gcgcaatgcg        60
     caggggcaat tcagtctgtg gccgcaacaa tgcgccttac cggcaggctg ggacattgtg       120
     tgtcagccgc agtcacaggc gtcctgccag cagtggctgg aagtccactg gcgtactctg       180
     acaccggcca atttcaccca gttgcaggag gcacaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page