(data stored in ACNUC10821 zone)

EMBL: AP010958.YBEB

AP010958.YBEB        Location/Qualifiers
FT   CDS_pept        complement(706400..706717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="ECO103_0644"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29507"
FT                   /db_xref="GOA:C8U2Z9"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Z9"
FT                   /protein_id="BAI29507.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     ttgcagggta aagcactcca ggattttgtt atcgacaaaa ttgatgacct caaaggtcag        60
     gacatcatcg ccttagacgt tcaaggcaaa tccagcatca ccgactgcat gatcatctgt       120
     acgggtacgt ccagccgtca tgttatgtcc attgctgacc acgttgtgca ggagtctcgc       180
     gcagcgggcc tgttaccgct cggcgtagaa ggtgaaaaca gcgccgactg gattgtcgtg       240
     gatttgggcg atgtgattgt ccatgtcatg caggaagaga gccgtcgcct gtatgaactg       300
     gaaaaactct ggagttaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page