(data stored in ACNUC10821 zone)

EMBL: AP010958.YBER

AP010958.YBER        Location/Qualifiers
FT   CDS_pept        714392..715099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECO103_0652"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29515"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:C8U307"
FT                   /protein_id="BAI29515.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDARDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYRNWRQYFA
FT                   GYTFGRQYWQSPEDDHLQLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSWQPLAYY
FT                   SACPETLKDMSDL"
     atggacatgg agtcgcaaaa aatattgttt gcactttcca ctccgatgga aatacgcaat        60
     gaatgctgtt taccttcgca ttcatcaccc aaaatgtatt taggtacatg cttttttgac       120
     ctttcttcct cctggggaat tgatgcccgt gatgacctgc tgcgcacaat tcaccgaatg       180
     atcgataacg gtcatgccgc tcggttggca gggttttatc accgctggtt tcgttattcg       240
     ccatgtgaat ggcgtgacta tcttgctgaa ctaaatgagc aaggtcaggc ttatgcgcaa       300
     tttgtcgcca gcaccgccga atgctgtggt gagggaggaa ttaaagcctg ggattatgtc       360
     cggatgggtt ttttaagccg aatgggcgta cttaataact ggttgagcga agaagaaagt       420
     ctatggatcc agtcgcgcat tcatctacgg gctctacgtt attatcgtaa ctggcggcaa       480
     tactttgccg gttatacctt tggtcggcaa tattggcagt ctcccgaaga tgatcatctg       540
     cagttattac gcgaattctt agcgcgtaaa gaatacgacg attccggcaa tgatatgttt       600
     tatcaattat ttgccagtga tgatgcgtat taccctacct tgtcctggca accattggct       660
     tactattctg catgcccgga aacgcttaag gatatgagcg acctatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page