(data stored in ACNUC10821 zone)

EMBL: AP010958.YBET

AP010958.YBET        Location/Qualifiers
FT   CDS_pept        complement(716533..717087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECO103_0654"
FT                   /product="conserved predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29517"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8U309"
FT                   /protein_id="BAI29517.1"
FT                   /translation="MNKKLMYIFAIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPLTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGTGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
     atgaataaaa aattaatgta tatattcgca atatttatag ttgcagcaat tacctgtatt        60
     agccaaccca agaaaacaac gttgcgtgat aaagccatgg tgaattatgc ctttgattat       120
     ttaagctcac caggcagtct accgttaacc acggcagcca cggagctttc cgcgattcat       180
     ggtcactcaa catcgcaata tcgccttggc gaattttatc ttcatggtag cgacggtaaa       240
     ccactggatt atacacaggc gagatactgg tatgagcaat cagcagaaca ggaaaatccg       300
     cgcgcacaaa gcaaactggg gtggatctac ctgaaaggcc tgggagtcaa acccgatacc       360
     cgtaaagcaa ttctctggta taaggaagca gctgaacaag ggtatgctca tgctcaatat       420
     actttgggtt tgatctacag aaatggcact ggtattaatg ttaaccatta tgaatctcaa       480
     aaatggttaa aactggccgc caaacaacat tacaaaaatg cggaaagatt acttgccggg       540
     cttcccgcac attaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page