(data stored in SCRATCH zone)

EMBL: AP010958.YBEY

AP010958.YBEY        Location/Qualifiers
FT   CDS_pept        complement(730368..730835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECO103_0666"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29529"
FT                   /db_xref="GOA:C8U321"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C8U321"
FT                   /protein_id="BAI29529.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
     atgagtcagg tgatcctcga tttacaactg gcatgtgaag ataattctgg gttaccggaa        60
     gagagccagt ttcaaacatg gctgaatgcg gtgatcccgc agtttcagga agaatcggaa       120
     gtgactattc gcgtggtcga taccgccgaa agccacagtc tgaatctgac ctatcgcggt       180
     aaggataagc cgaccaacgt gctctccttc ccgtttgaag tgccgcctgg catggaaatg       240
     tcgctactgg gcgatctggt tatctgccgt caggtggttg agaaggaagc tcaggagcaa       300
     ggcaaaccac tggaggcgca ctgggcgcat atggtggtgc acggcagtct gcatttgtta       360
     ggttacgatc acatcgaaga tgacgaagca gaagaaatgg aagccctcga aacagagatt       420
     atgcttgctc tgggctatga ggatccgtac attgccgaga aagaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page