(data stored in ACNUC10821 zone)

EMBL: AP010958.YBEZ

AP010958.YBEZ        Location/Qualifiers
FT   CDS_pept        complement(730832..731911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECO103_0667"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains nucleoside triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29530"
FT                   /db_xref="GOA:C8U322"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U322"
FT                   /protein_id="BAI29530.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMSGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
     atgttcagct tccggcggca tacagataag aggaacggtt tgaacataga cactcgcgaa        60
     atcaccctgg agccagcaga caatgcgcgt ctgttgagcc tgtgcggccc gtttgatgac       120
     aacatcaagc agctcgaacg ccgtctcggc atcgagatca atcgccgcga caaccacttt       180
     aaactgaccg gccgtccgat ttgcgtcacc gctgcggcag acattctgcg tagcctgtat       240
     gtcgatacag ccccgatgag cggtcagatt caggatatcg aaccggaaca gatccacctt       300
     gcgattaaag aagcgcgagt actggagcaa agtgcggaga gcgtgccgga gtacggcaaa       360
     gcggtcaata tcaaaaccaa acgcggcgta attaagccgc gcacgccaaa ccaggcgcag       420
     tacatcgcca atattctcga ccatgacatt accttcggcg ttggcccggc gggtacgggt       480
     aaaacctacc tggcagtggc tgcggcagtt gatgccctgg agcgtcagga gattcgccgt       540
     attctgctga ctcgtccggc ggtcgaagcc ggtgagaaac tgggcttcct gcctggcgat       600
     ttaagccaga aagtagaccc gtatctgcgc ccgctgtacg acgcgctgtt tgaaatgctg       660
     ggctttgaga aagttgagaa actgattgag cgcaacgtta ttgaagtcgc gccgctggcc       720
     tatatgcgtg gtcgtacgct gaacgacgcg tttatcattc tcgatgagag ccagaacacc       780
     accatcgaac agatgaagat gttcctgacc cgtatcggtt ttaactcaaa agcggttatc       840
     accggcgacg tcacacagat cgacctgccg cgtaatacta aatcaggctt acgtcacgcc       900
     atcgaagtgc tggccgatgt cgaagagatc agctttaact tcttccacag cgaagacgtg       960
     gttcgtcacc cggtggtggc gcgtatcgtt aacgcctatg aagcctggga agaagccgaa      1020
     caaaaacgaa aagcggcgct ggcggcagaa cgcaagcgcg aagaacagga acaaaaatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page