(data stored in ACNUC10821 zone)

EMBL: AP010958.YKFM

AP010958.YKFM        Location/Qualifiers
FT   CDS_pept        complement(238995..239474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfM"
FT                   /locus_tag="ECO103_0211"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29087"
FT                   /db_xref="GOA:C8U1S9"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1S9"
FT                   /protein_id="BAI29087.1"
FT                   /translation="MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTE
FT                   IFYDWRMLILCFGFMSFSFLNIHVILLTIIKSFLIKKTKVVNFATDITIQLTLIFLLIA
FT                   IVIAPLIAPFVTGYVNANYHPCGNNTGIFPGAIYIKNGMKCNNEYISRKEDSAVK"
     atgcgtttac atgttaaatt aaaagagttt ctttcgatgt tttttatggc catattattt        60
     ttccctgcat tcaatgcttc tttgtttttt accggagtta aacctctata ttcaataata       120
     aaatgctcca cggaaatatt ttatgattgg agaatgttga ttctgtgctt tggtttcatg       180
     tcgttttcct ttttaaatat tcatgtaatt ttacttacga taataaaatc attcttaatc       240
     aaaaaaacga aggtagtcaa tttcgccaca gacataacaa tacagctaac tcttatattt       300
     ttactaatag ctatcgtaat agcaccttta atagctcctt ttgtcacagg atatgtcaat       360
     gctaattatc acccctgcgg taataatacg gggattttcc caggagcaat ctatattaaa       420
     aatggcatga aatgtaataa tgaatatatt tctcgcaagg aagattcagc agttaaataa       480
//

If you have problems or comments...

PBIL Back to PBIL home page