(data stored in SCRATCH zone)

EMBL: AP010960.CUSA

AP010960.CUSA        Location/Qualifiers
FT   CDS_pept        645916..649059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="ECO111_0602"
FT                   /product="copper/silver efflux system protein CusA"
FT                   /note="membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34574"
FT                   /db_xref="GOA:C8UJP1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJP1"
FT                   /protein_id="BAI34574.1"
FT                   /translation="MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPY
FT                   WARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWF
FT                   LKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSI
FT                   ELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKVQIGPEMRRGIAELNGE
FT                   GEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSG
FT                   KLLEEFIVVAVVCALFLWHVRSALVAIISLLLGLCIAFIVMHFQGLNANIMSLGGIAIA
FT                   VGAMVDAAIVMIENAHKRLEEWQHQHPDATLDNKTRWQVITDASVEVGPALFISLLIIT
FT                   LSFIPIFTLEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWIRGKIPPESSNPL
FT                   NRFLIRVYHPLLLKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQINEGDLLYMPST
FT                   LPGISAAEAASMLQKTDKLIMSVPEVARVFGKTGKAETATDSAPLEMVETTIQLKPQEQ
FT                   WRPGMTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVSGTVLADID
FT                   AMAEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVADVQLFVTSAVGG
FT                   AMVGETVEGIARYPINLRYPQSWRDSPQALRQLPILTPMKQQITLADVADIKVSTGPSM
FT                   LKTENARPTSWIYIDARDRDMVSVVHDLQKAIAEKVQLKPGTSVAFSGQFELLERANHK
FT                   LKLMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWMGFHLSVATGTGF
FT                   IALAGVAAEFGVVMLMYLRHAIEAEPSLNNPQTFSEQKLDEALYHGAVLRVRPKAMTVA
FT                   VIIAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLMWLHRHRVRK"
     atgattgaat ggattattcg tcgctcggtg gcgaaccgtt ttttggtgct gatgggcgcg        60
     ttgtttctga gcatctgggg cacctggacc atcattaata cgccagtgga tgcgctgccg       120
     gatctctccg atgtgcaggt tattattaaa accagctatc ccggtcaggc accacaaatc       180
     gttgaaaatc aggtgactta tccgctaacc accaccatgt tgtcggtgcc tggcgcgaag       240
     actgtgcgcg gtttctcaca gtttggcgac tcttatgtgt atgtcatttt cgaagatggc       300
     accgatccgt actgggcgcg ttcgcgggtg ctggagtacc tcaaccaggt acagggtaag       360
     ctgcctgcgg gagtcagcgc cgagctggga ccagatgcca cgggtgttgg ctggatctat       420
     gaatatgcac tggtggatcg cagcggtaag cacgatctgg ccgatttacg ctcattgcag       480
     gactggtttc tcaaatatga gctgaaaacc atccctgacg ttgcggaagt ggcgtcggtg       540
     ggcggtgtgg tgaaagagta tcaggtggtt atcgatcccc agcgcctggc gcagtatggc       600
     atcagtctcg ccgaagtaaa aagcgcgctg gatgcttcaa accaggaagc gggcggttcg       660
     tcgatcgaac tggcggaagc ggaatatatg gtgcgcgcca gcggctatct gcaaacgctc       720
     gacgacttta atcacatcgt tttaaaagcc agtgaaaatg gcgtgcccgt ttatctgcgc       780
     gatgttgcga aggtccagat tggcccggag atgcgccggg gcattgccga actaaacggc       840
     gaaggcgaag tggcgggcgg ggtggtgatc ctgcgatccg gcaaaaacgc ccgagaagtg       900
     atcgccgccg tgaaggacaa actggaaacg ctgaaaagta gtctgccgga aggcgtggag       960
     atagttacaa catacgatcg cagccagctc attgaccgcg ccatcgacaa cctcagcggc      1020
     aagttgctgg aagagtttat tgtggtggcg gtagtctgtg cgctgtttct ctggcatgtg      1080
     cgctcggcgc tggtggcgat tatttcgttg ctgctggggt tgtgtattgc ttttattgtc      1140
     atgcacttcc agggactgaa tgccaatatt atgtcgttgg gcggcattgc gattgccgtc      1200
     ggggcgatgg tcgatgccgc tatcgtcatg atcgaaaatg cacataaacg gctggaagag      1260
     tggcagcacc agcatcctga cgccacgctg gataataaaa cgcgctggca ggtgatcacc      1320
     gatgcatctg ttgaagtggg tccggcgcta tttatcagtc tgctgattat cacgttgtcg      1380
     tttatcccga tcttcaccct ggaagggcag gaagggcgtc tgtttggccc gctggcgttc      1440
     accaaaacgt atgcgatggc gggtgcggcg ctgctggcga tcgtagtgat ccctatcctg      1500
     atgggttact ggatccgtgg caaaattccg ccggaaagca gtaacccgct caatcgcttt      1560
     ttgattcgtg tttatcatcc gctgttgctg aaagtactgc actggccgaa aaccacgctg      1620
     ttggtggcag cgctttcggt gctgacggtt ctctggccgc tcaataaagt tggcggggaa      1680
     tttttaccgc agatcaatga aggcgacctg ttgtatatgc catcgacgct gccggggatt      1740
     tccgcagcag aggcggcgag tatgctgcaa aaaaccgaca agctaattat gagcgtacct      1800
     gaagtggcgc gggtatttgg caaaaccggg aaagcggaaa ccgccaccga ttctgctccg      1860
     ctggagatgg tagaaacgac catccagctt aagccgcagg agcagtggcg gccaggcatg      1920
     acaatggaca aaatcattga ggaactggat aacaccgtgc gtctgccggg gctggcgaat      1980
     ctgtgggtgc cgccaattcg taaccgtatc gatatgctct caaccggcat taaaagcccc      2040
     atcggcatta aagtttccgg cactgtgctg gcggatatcg acgcgatggc tgagcaaatt      2100
     gaagaagtag cgcgaacggt gccaggcgtg gcttctgctc tagccgagcg tctggaaggt      2160
     gggcgctata tcaacgttga gattaaccgt gaaaaagccg cacgttacgg tatgacggtg      2220
     gcggatgtgc agttgtttgt gacttctgcg gtgggcgggg cgatggttgg cgaaacggtg      2280
     gaagggattg cccgttatcc aattaatctg cgttatccgc aaagctggcg cgatagtccg      2340
     caggcactgc gccagttgcc gatcctgacg ccgatgaagc agcaaatcac cctggcagac      2400
     gtggccgaca ttaaagtctc taccggaccg tcaatgctga aaaccgagaa tgcgcgcccg      2460
     acgagctgga tttatatcga tgcccgcgat cgtgacatgg tgtcggtggt tcacgatttg      2520
     caaaaagcga tagctgaaaa agtgcagtta aaaccgggca ccagcgtggc attctccggg      2580
     cagttcgagc tactggagcg cgccaaccat aagcttaaac tcatggtgcc gatgacgttg      2640
     atgattatct tcgtgctgtt gtatctggcg ttccgtcggg tgggcgaagc gttgctgatt      2700
     atcagcagcg taccgtttgc gctggtgggc ggcatctggt tgctgtggtg gatgggcttt      2760
     catctttccg tggcgacggg cactggcttt atcgccctcg ccggggtcgc cgccgaattt      2820
     ggcgtggtga tgctgatgta tttacgtcac gccatagagg ccgagccgtc gttgaataat      2880
     ccacaaacat tcagcgagca gaagctggat gaggcgttat atcacggcgc ggtcctgcgc      2940
     gtgcgcccga aagcgatgac ggtggcggtg attatcgccg gtctgctgcc gattctgtgg      3000
     ggaacggggg ctggttcaga ggtgatgagc cggattgccg caccgatgat tggcggcatg      3060
     atcaccgcac ctttgctgtc gctgtttatt atcccggcgg cgtataagct gatgtggctg      3120
     caccgacatc gggtacggaa ataa                                             3144
//

If you have problems or comments...

PBIL Back to PBIL home page