(data stored in SCRATCH zone)

EMBL: AP010960.HOKC1

AP010960.HOKC1       Location/Qualifiers
FT   CDS_pept        complement(15387..15539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokC1"
FT                   /locus_tag="ECO111_0016"
FT                   /product="small toxic membrane peptide HokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34020"
FT                   /db_xref="GOA:C8UFZ1"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:C8UFZ1"
FT                   /protein_id="BAI34020.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFT
FT                   AYESE"
     atgaagcagc ataaggcgat gattgtcgcc ctgatcgtca tctgtatcac cgccgtagtg        60
     gcggcgctgg taacgagaaa agacctctgt gaggttcaca tccgaactgg ccagacggag       120
     gttgctgttt tcacggctta cgaatccgag taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page