(data stored in SCRATCH zone)

EMBL: AP010960.LFGB

AP010960.LFGB        Location/Qualifiers
FT   CDS_pept        300091..300426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgB"
FT                   /locus_tag="ECO111_0272"
FT                   /product="predicted lateral flagellar rod protein"
FT                   /note="FlgB-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34261"
FT                   /db_xref="GOA:C8UHC8"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C8UHC8"
FT                   /protein_id="BAI34261.1"
FT                   /translation="MGISFQQALGVHPQAVKLRLERTELLTANLANVDTPNFKAKDIDF
FT                   AREMQRANNAAVDVQYRVPMQPSEDGNTVELNSEQARFSQNSMDYQSSLTFLNLQISGI
FT                   REAIEGK"
     atggggatca gttttcagca ggcattggga gtacatccgc aggcagtgaa gttacgtctt        60
     gagaggaccg agctactgac tgcgaatctg gcgaacgtcg atacgccaaa tttcaaggct       120
     aaagatattg attttgccag ggagatgcaa cgggcaaata acgcggcggt ggatgtccag       180
     taccgcgtgc cgatgcagcc gtcggaagat ggcaacaccg tggaactgaa cagcgagcag       240
     gcgcggtttt cacaaaatag tatggattat caaagcagtt tgacctttct gaatctgcaa       300
     atcagcggca tcagagaggc cattgaaggg aaataa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page