(data stored in SCRATCH zone)

EMBL: AP010960.LFGD

AP010960.LFGD        Location/Qualifiers
FT   CDS_pept        300860..301573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgD"
FT                   /locus_tag="ECO111_0274"
FT                   /product="predicted lateral flagellar hook assembly
FT                   protein"
FT                   /note="FlgD-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34263"
FT                   /db_xref="GOA:C8UHD0"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="UniProtKB/TrEMBL:C8UHD0"
FT                   /protein_id="BAI34263.1"
FT                   /translation="MNTLALNAQSPQPTATAESNNVAASDTQSSSDSSPVDTFLTLFVA
FT                   EIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANTNAVLMSNIQVMALGNLVGDDI
FT                   MVQTTALQVSDQTINGRATLDDACTTADLHFTDAAGDDYTVSLIPEGSSSVGPGQVDFS
FT                   VNPADYGIPPGDYDVSVVTNTGEEEVPIEVSGEVEDVRIPLDGSSPVLNVAGVGEVPFT
FT                   MISQFGVPDADSDVA"
     atgaataccc tggcgctgaa tgcgcaatcg ccgcagccga ccgccacggc ggaaagcaat        60
     aatgtggcgg ccagcgacac gcaaagcagc agcgatagct cgcctgtcga taccttcctg       120
     acgctgtttg tcgccgagat ccaaaaccag gacccgaccg acccgaccga cgctaccgaa       180
     tacatcgacc agctgtcgtc gatggcgcag gtggcgatga tggaagagat gagcgtgcag       240
     gccaacacca acgcggtgct gatgagcaac attcaggtga tggcgctcgg taacctggtg       300
     ggcgacgaca ttatggtgca gaccaccgcc ttgcaggtga gcgaccagac cattaacggt       360
     cgcgctacgc tggacgacgc ctgtaccacc gccgatctcc actttaccga tgccgcaggc       420
     gatgactaca ccgtctcgct gatcccagaa ggcagttcgt ccgtcggacc aggccaggtt       480
     gatttctcgg tgaatcccgc ggattacggc atcccgccgg gcgattacga cgtctcggtg       540
     gtgaccaata ccggggaaga agaggtgccg attgaagtct ccggcgaagt ggaagatgtg       600
     cgcatcccgc tcgacggcag ttccccggtg cttaacgttg caggcgtggg cgaagtgccg       660
     ttcaccatga ttagccagtt tggcgtaccc gatgccgaca gtgatgtggc gtaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page