(data stored in SCRATCH zone)

EMBL: AP010960.LFIQ

AP010960.LFIQ        Location/Qualifiers
FT   CDS_pept        complement(285190..285462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiQ"
FT                   /locus_tag="ECO111_0255"
FT                   /product="predicted lateral flagellar biosynthesis protein"
FT                   /note="FliQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34244"
FT                   /db_xref="GOA:C8UHB1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:C8UHB1"
FT                   /protein_id="BAI34244.1"
FT                   /translation="MLTIDVAADIVASGIKVVILLVSVLVVPSLLVGLLVSVFQAVTQI
FT                   NEQTLSFLPRLIVTLVVLGVCGKWMIIQLHDLCIHLFTQAALLVH"
     atgctgacca tagacgtagc cgccgacatt gtcgccagcg gcataaaagt ggtgattttg        60
     ctggtttcgg tgctggtagt gccgagcctg ctggtcggcc tgctggtgag cgtgttccag       120
     gcggtaacgc agattaacga acagacccta agctttttgc cgaggctgat tgtcacgctg       180
     gtggtgctgg gcgtgtgcgg taaatggatg attatccagt tgcatgatct ctgcattcac       240
     ctgtttaccc aggccgcgtt gctggttcat tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page