(data stored in SCRATCH zone)

EMBL: AP010960.PE234

AP010960.PE234       Location/Qualifiers
FT   CDS_pept        complement(260764..261264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0234"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34225"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C8UH92"
FT                   /protein_id="BAI34225.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSPLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGLV
FT                   SNK"
     atgagcaaaa aatttgaagg cagcgtcgcg cctcgcgagc gtattaatat atcgtatgtc        60
     ccaaaaacag atggccagac ggctgaagtg gaacttccgc ttaacatgct cgttgtcggc       120
     gataccggaa atacgcagga aacatcccca ctggatgaac gtcaggcagt ttccgttaac       180
     aagcacaatt tcggtgcagt gatggctgaa gcagccattg gcctcaattt tactgtcccc       240
     gccacgctga agggaagcac aacagacgat gaactgaatg tggcgctgaa tatcaaatca       300
     ctggatgatt tttcaccaga tagcgtggcc cggcaggttc cggaagtgaa taaattgctg       360
     gaactgcgtg aagcactgac tgcactgaag gggccgatgg gtaaccttcc ggcattccgt       420
     acccagctcc aggcattgct ggaaaatgaa gagtcccgcg agcagttgct caaagaaatc       480
     ggtctggtga gcaataaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page