(data stored in SCRATCH zone)

EMBL: AP010960.PE236

AP010960.PE236       Location/Qualifiers
FT   CDS_pept        262689..264830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0236"
FT                   /product="VgrG protein"
FT                   /note="RhsG"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34227"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C8UH94"
FT                   /protein_id="BAI34227.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFQQILDKMAYLTIWQGDDVQRRVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTT
FT                   LDNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQESSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
     atgtcaaccg gattacgttt cacgctggaa gtggacggcc tgccaccgga tgcttttgcg        60
     gtggtctcct ttcatctgaa ccagtcactc tcttcgcttt tttccctcga tctctctctg       120
     gtcagccagc agtttctctc ccttgaattc cagcagatcc tcgacaaaat ggcctacctg       180
     acgatatggc agggcgatga cgtacagcgc cgggtgaaag gtatggtgac ctggtttgaa       240
     ctgggggaga acgacaaaaa ccagatgctg tacagcatga aggtgtgccc accgctgtgg       300
     cgcacagggc tgcgccagaa cttccgtatc ttccagaatg aggacatcga aagcatcctc       360
     ggcacgatat tgcaggaaaa cggggtgacc gagtggagcc cgctgttcag cgagccacat       420
     ccttcccgtg agttttgtgt ccagtacggt gagactgatt acgatttcct gtgccggatg       480
     gcggcggagg aaggcatctt cttttatgag gagcacgcgc aaaaaagtac cgaccagagc       540
     ctggtcctgt gcgataccgt gcgttatctg ccggagtcct ttgagatccc ctggaatccg       600
     aacacccgta ccgaggtgag caccctctgc atcagccagt ttcgctacag cgcacaaatc       660
     cgcccttctt ccgtggtgac caaagactac acctttaaac gacccggctg ggcagggcgt       720
     tttgatcagg aaggccagta ccaggattac cagcgcacac agtatgaagt gtatgactac       780
     cccggacgtt tcaagggtgc ccacgggcag aactttgccc gctggcagat ggatggctgg       840
     cgcaacaacg cagaagtggc gcgcggaaca agccgttcgc cggagatatg gccgggacgg       900
     cgaattgtgc tgacggggca tccgcaggcg aacctgaacc gggaatggca ggtggtggca       960
     agtgaactgc acggcgaaca gccgcaggcg gtaccgggac gcaggggttc aggcaccacg      1020
     ctggataacc actttgcggt aatcccggca gaccggacat ggcggccaca gccgttgctg      1080
     aaaccgctgg tggacggccc gcagagcgcc gtcgtgacgg gaccggcagg cgaggaaatc      1140
     ttctgtgatg aacatggccg cgtgcgggtg aaatttaact gggaccgcta taacccgtca      1200
     aaccaggaaa gttcatgctg gatccgtgtg gcacaggcgt gggcaggcac cggctttggt      1260
     aacctggcga taccgcgtgt gggtcaggag gtcattgtgg acttcctcaa cggcgatccg      1320
     gaccagccga tcattatggg gcgtacctac caccaggaaa accgcacccc cggcagcctg      1380
     ccggggacga agacgcagat gacgatccgc tcgaaaacct ataagggcag cgggtttaat      1440
     gaactgaagt ttgacgatgc gacagggaaa gaacaggtct acatccacgc gcagaagaac      1500
     atgaacaccg aggtgctgaa taaccgcacc actgatgtga taaacaacca tgccgaaaaa      1560
     ataggtaaca accaggcgat caccgttacc aataaccaga tccagaacat tggcgttaat      1620
     cagatacaga cggttggtgt caaccaggtg gaaacggtgg gcagtaacca gattatcaaa      1680
     gtgggatcaa accaggttga aaaggtgggg atcattcgtg cgctgacggt gggtgtggct      1740
     taccagacga cggtaggcgg cattatgaat acctcggtgg cgttgttgca gtcctcacag      1800
     gtagggctgc ataaatcact gatggtggga atgggctaca gcgtcaatgt ggggaataac      1860
     gtcaccttct cggtgggcaa gacaatgaag gaaaacaccg gacaaacagc agtttattct      1920
     gccggtgagc atcttgaact ctgctgtggt aaggcaaggc tggtgctgac gaaggacgga      1980
     agcatatttc tcaatggtac gcacattcat ctggaagggg agtcggatgt gaacggtgat      2040
     gcgccagtga ttaactggaa ctgtggtgcc acacaacctg taccggatgc gcctgtgccg      2100
     aaagatttac cccccggaat gccggatatg cggcaatttt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page