(data stored in SCRATCH zone)

EMBL: AP010960.PE313

AP010960.PE313       Location/Qualifiers
FT   CDS_pept        complement(334762..335640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0313"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO111_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34300"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:C8UI72"
FT                   /protein_id="BAI34300.1"
FT                   /translation="MFLRGHGLFAFISLSDKELIMRLASRFGRINQIRRDRPLTHEELM
FT                   HYVPSIFGEDRHTSRSERYSYIPTITVLESLQREGFQPFFACQTRVRDPGRRGYTKHML
FT                   RLRRDGEINGQHVPEIILLNSHDGTSSYQMLPGYFRFVCQNGCVCGQSLGEVRVPHRGN
FT                   VVDRVIEGAYEVVGVFDRIEEKRDAMQSLVLPPPARQALAQAALTYRYGDEHQPVTTAD
FT                   ILTPRRREDYGKDLWSAYQTIQENMLKGGLSGRSAKGKRIHTRAIHSIDTDIKLNRALW
FT                   VMAETLLESMR"
     atgttcctcc ggggacatgg cctttttgct tttatttcat tatcagataa ggagttaatt        60
     atgcgattag ccagtcgctt cggacggatt aatcagatac gccgtgaccg cccactgacc       120
     catgaagaac tgatgcacta tgttcccagc atttttgggg aagaccggca tacctcccgc       180
     agtgaacggt attcgtacat ccccaccatc acagtgctgg aaagcctgca gcgggaaggc       240
     tttcagccat tcttcgcctg ccagacccgc gtacgtgacc cgggccgccg ggggtatacc       300
     aaacacatgc tgcgtctgcg ccgtgacggg gagataaacg gacaacatgt ccctgaaatt       360
     attctgctca actcccatga cggtacctcc agctaccaga tgctgccggg ttacttcaga       420
     ttcgtctgcc agaacggctg cgtctgtggt cagtctctgg gggaagtgcg tgttccgcac       480
     cggggaaatg tggtggacag agtcattgaa ggggcttacg aggtggtggg tgtgtttgac       540
     cggatagagg agaagcgtga tgccatgcag tcgctggtcc tgccgccacc ggcacgccag       600
     gcgctggcac aggcggcact gacttaccgt tatggtgacg aacatcagcc cgtcaccacc       660
     gccgacattc tgacaccacg acgcagggag gattacggta aggacctgtg gagtgcttat       720
     cagaccatcc aggagaatat gctgaaaggc gggctttccg gtcgcagtgc aaaaggaaaa       780
     cgtatccaca cccgtgccat tcacagcatc gataccgaca ttaagctcaa ccgggcattg       840
     tgggtgatgg cagaaacgct gctggagagc atgcgctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page