(data stored in SCRATCH zone)

EMBL: AP010960.PE325

AP010960.PE325       Location/Qualifiers
FT   CDS_pept        complement(343156..343347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO111_0325"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO111_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34312"
FT                   /db_xref="UniProtKB/TrEMBL:C8UI84"
FT                   /protein_id="BAI34312.1"
FT                   /translation="MTPREIELLTIAKLEHGGHQLSPAELRELRRQLAEGPVIARRYRE
FT                   MMTSPAYRWSKPAPLRAR"
     atgacaccac gagaaatcga gctgctgacc attgccaagc tggagcatgg cggccaccag        60
     ctcagcccgg cagaactgcg ggaattaagg cgccagctgg cagagggccc tgtaatagcc       120
     aggcggtacc gcgaaatgat gaccagcccc gcatatcgct ggagcaaacc agcgccgctc       180
     cgtgcgcggt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page