(data stored in SCRATCH zone)

EMBL: AP010960.SFMF

AP010960.SFMF        Location/Qualifiers
FT   CDS_pept        606305..606820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECO111_0566"
FT                   /product="predicted fimbrial-like adhesin protein SfmF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34541"
FT                   /db_xref="GOA:C8UJK8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8UJK8"
FT                   /protein_id="BAI34541.1"
FT                   /translation="MRRVLFSCFCGLLWSSIGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     atgagaagag tactctttag ctgtttctgc gggttactgt ggagttccat tggatgggca        60
     gctgaccctt taggaacgat taatatcaat ttgcacggta acgttgttga tttctcctgt       120
     accgtaaaca cagcggatat tgataagacg gtagatttag gcagatggcc tacgacacaa       180
     ttactgaacg ctggcgatac cacggcactc gtccctttta gcctgcggct ggagggatgt       240
     cctccgggtt cagttgcgat tttatttacg ggaacgccgg catccgatac caacctgctg       300
     gctctggatg atcccgcaat ggcacaaacc gtcgccatcg aattacgtaa tagcgatcgc       360
     tcccggctcg cactggggga ggcgagcccg actgaggaag tagatgcaaa tggcaatgtc       420
     acactaaact tttttgccaa ttatcgagcg ttagccagcg gtgttcggcc aggtgtggcg       480
     aaagcggatg cgatatttat gatcaattat aattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page