(data stored in SCRATCH zone)

EMBL: AP010960.YACG

AP010960.YACG        Location/Qualifiers
FT   CDS_pept        complement(113289..113486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="ECO111_0103"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34104"
FT                   /db_xref="GOA:C8UGX1"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C8UGX1"
FT                   /protein_id="BAI34104.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
     atgtcagaaa ctattacggt gaattgccca acctgcggga aaacggtggt gtggggtgaa        60
     atcagcccgt ttcggccatt ttgctccaaa cgttgtcagc tgatcgacct cggagaatgg       120
     gctgctgaag aaaaacgaat ccccagcagt ggcgatcttt ccgaaagcga tgactggagc       180
     gaagagccaa agcagtga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page