(data stored in SCRATCH zone)

EMBL: AP010960.YAHL

AP010960.YAHL        Location/Qualifiers
FT   CDS_pept        389089..389904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECO111_0365"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34350"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIC2"
FT                   /protein_id="BAI34350.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFIDSVRTDCKCI
FT                   LLEHHMPLLRIFPKGKECMRVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIHPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
     atgatatcat taaaagctcc gcacaataat ttgatgccat atacgcaaca aagcatactt        60
     aatacggtta aaaacaatca gttaccagag gatatcaaaa gctccctggt ttcctgtgtc       120
     gatatattca aggttttgat taaacaatat tatgattatc cttatgattg tcgtgatgat       180
     ttagtcgatg acgacaaact cattcatctc atggctgccg tacgagactg tgagtggtca       240
     gacgataacg cactcaccat aaatgtgcag tttaatgatt tccctggatt ttatgactgg       300
     atggattacc ctgatcaccc ggttaagttt gtttttcgca tacttgaaaa tcaaaaaggg       360
     acagtttggg tatatgacca ggatgatgcg tttcttgata ttaaagcaaa tgtgcaggct       420
     ggacgcttta ccgggcttaa gaaattagtg cagtttatcg attcagtgcg aacagattgc       480
     aaatgtattc ttcttgaaca ccatatgcct ttgctgagaa ttttccctaa agggaaagag       540
     tgtatgcgtg tggaaaaatg gcttcgcgaa atgtcgtcta ttccggagac agacgcgccc       600
     attaagcagg cgcttgcgca tggattatta ttacacttaa aaaatatcca ccctgttttt       660
     cctgaatcac tggtgatgtt attgctctct gttctggacg taaaaacata cagagatgac       720
     gcacgattaa atgaatggat atcgaataga gtgcaggaat taggtgacag atattatcct       780
     gtaaataagc acgttaaaat ccgctacact ctttag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page