(data stored in SCRATCH zone)

EMBL: AP010960.YAIL

AP010960.YAIL        Location/Qualifiers
FT   CDS_pept        419998..420537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECO111_0390"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34375"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIE7"
FT                   /protein_id="BAI34375.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     atggcaaaac ttaccttaca agagcagttg ctcaaagcag gattagtcac cagcaaaaaa        60
     gcggcgaagg tggagagaac ggcgaaaaaa tcgcgcgttc aggcgcgtga agctcgggcg       120
     gcggtagaag aaaataaaaa ggcacagctt gagcgtgata aacagcttag cgagcaacaa       180
     aaacaagctg cgttggcgaa agaatataaa gctcaggtga agcagctcat tgaaatgaac       240
     cgaatcacca ttgccaatgg cgatattggt tttaacttca ctgacggcaa tctgattaag       300
     aagatttttg tcgataagct cacacaggcg cagttgatta atggtcgtct ggcgattgct       360
     cgcttgttgg tcgataacaa tagcgaaggt gaatacgcca ttattcccgc cagcgttgcc       420
     gataaaatag ctcagcgtga tgccagcagt atagtgttgc acagcgcgct cagcgccgaa       480
     gagcaggatg aagacgaccc atatgccgac ttcaaagtgc ctgatgattt gatgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page