(data stored in SCRATCH zone)

EMBL: AP010960.YBAP

AP010960.YBAP        Location/Qualifiers
FT   CDS_pept        complement(551767..552561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECO111_0517"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO111_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAI34494"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:C8UIR6"
FT                   /protein_id="BAI34494.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
     atggatctgt tgtaccgggt aaaaacgctt tgggccgcgc tgcgcggtaa tcattacacc        60
     tggcctgcca tcgatatcac ccttcccggc aatcgccatt ttcatctgat tggcagtatt       120
     catatgggta gccacgatat ggctcccctg cccacccgtt tgctcaaaaa gctcaaaaac       180
     gccgatgcgc tgatcgtcga ggcggatgtt tccaccagcg atacgccttt tgccaatttg       240
     cctgcctgcg aggcgctgga agagcgcatt agcgaggagc aactccaaaa tctgcagcac       300
     attagccagg agatgggcat ttctccctca ctcttttcta cccaaccgct gtggcaaatc       360
     gcgatggttc ttcaggcgac gcaggcacaa aaactggggc tgcgggcaga atacggtatc       420
     gattaccagc tattgcaggc ggcgaagcaa caacataaac ccgtgattga actggaaggg       480
     gctgaaaacc agattgccat gttgctccag ctccctgaca aaggactggc gctgctggac       540
     gatacactga cccactggca caccaatgca cggttgctgc aacaaatgat gagctggtgg       600
     ctgaatgcac cgccgcaaaa taatgaaata acgctgccca atacgttcag tcagtcgctg       660
     tacgatgtgc tgatgcatca gcgaaatctc gcctggcggg ataaattacg cgccatgccg       720
     ccggggcgat atgtggtcgc ggtcggtgca ctacacctgt atggagaagg gaatttaccg       780
     caaatgttgc gctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page