(data stored in ACNUC7421 zone)

EMBL: AP011115.ACN

AP011115.ACN         Location/Qualifiers
FT   CDS_pept        55379..58177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acn"
FT                   /locus_tag="ROP_00660"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="protein synonym:aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48313"
FT                   /db_xref="GOA:C1AS64"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS64"
FT                   /protein_id="BAH48313.1"
FT                   /translation="MSGNSFGARSTLTVADQTYGIYRLDAIETDVQLPYSMKVLLENLL
FT                   RNEDGRLVTAGQVSALASWSPRNPGHTEIQFTPARVLMQDFTGVPCVVDLVAMRDAMTA
FT                   LGGDPRKINPLIPTELVIDHSVIADVFGRPDAYRVNADLEFSRNKERYQLLRWAQQAFD
FT                   DFLVVPPDTGICHQVNLEYLARVVFTQETPDGPLAYPDTLVGTDSHTPMINGLGVLGWG
FT                   VGGIEAEAAMLGQPMSMLLPQVLGLKLTGALPEGTTATDLVLTIAELLRKTGVVGKFVE
FT                   FYGPGVANVPLANRATLGNMSPEYGSTCAIFPIDDETLNYLRLTGRPEQQVRLVEAYAK
FT                   EQGMWHDPDQEPAYSHTVELDLATVEPSIAGPKRPQDRIPLASAPHAVGSLLAGQPLPT
FT                   ALDAGLDEASGESFPASDPIAVDHDRASDGPAAPCRCGKSHVWPSDPVEVVLDGEVHSV
FT                   DHGHVVIAAITSCTNTSNPSVMIGAGLLAKKAVQAGLTRKPWVKTSLAPGSRVVTDYYD
FT                   RAGLTPYLERLGFGLVGYGCTTCIGNSGPLISQVSDAVTGHDLTACAVLSGNRNFEGRI
FT                   HAECKMNFLTSPPLVITYALAGTMLADVLHDPIGTGSDGRPVYLRDIWPSTEEVKAVID
FT                   ECLQSQMFTDGYSNVFAGDDNWRGLDVASGEIFEWHEDSTYVRRPPYFDGIQPEPQPIS
FT                   DITGARVLVMLGDSVTTDHISPAGTIRRGSPAGIYLREHGVEPPDFNSYGSRRGNHEVM
FT                   IRGTFANIRLRNLLAPGTEGGVTRHLPDGQEMSIFHAANAYAAEGTALIILAGAEYGSG
FT                   SSRDWAAKGTLLLGVKAVLATSFERIHRSNLIGMGVLPLQFPPGHTRESLGLTGEEEYS
FT                   ITGLEGGDPGADFPTEVTVRAHHHGQVQEFRATVRIDTPAEAGYFRHGGILQYVLRQLL
FT                   VT"
     gtgagcggca acagtttcgg cgcgcgctcc acactgacag tcgcagacca gacgtacggt        60
     atttaccggc tggatgcgat cgagaccgac gtgcagcttc cctacagtat gaaggtgctg       120
     ttggaaaatt tgctccgcaa cgaggacggc cgcctggtca ccgccgggca ggtctcggcc       180
     ctggcctcgt ggtcaccgcg caatcccggc cacaccgaaa tccaattcac cccagcccgg       240
     gtgcttatgc aggacttcac cggcgtgccg tgtgtggtcg acctggtggc gatgcgggat       300
     gcgatgacgg cgctgggcgg cgacccgcga aagatcaacc cgctcattcc caccgaattg       360
     gtcatcgatc actcggtgat cgcggacgtc ttcggccggc ccgacgccta ccgggtcaac       420
     gccgacctcg agttctcccg caacaaggag cgctaccaac tgttgcggtg ggcgcagcaa       480
     gccttcgacg attttctggt cgtgccaccc gataccggaa tctgccatca ggtcaacctc       540
     gaatacctgg cccgcgtggt gttcacacag gaaacaccgg acggccctct cgcctacccg       600
     gacactctcg tgggcaccga ctcgcacacc ccgatgatca acggcctcgg cgtgctcggt       660
     tggggagtcg gcgggatcga ggcggaggcg gccatgctcg gccagccgat gagcatgctc       720
     ctgccgcagg tcctcgggct caaactcacc ggcgccctac ccgagggcac caccgccacc       780
     gacctcgtcc tcacgatcgc cgagttgctc cgcaagaccg gggtcgtcgg caaattcgtg       840
     gagttctacg gccctggtgt cgccaacgtc ccgttggcca accgggcgac cctgggaaac       900
     atgagtcccg aatacggttc gacctgtgcc atcttcccca tcgacgacga gaccctcaac       960
     tatctgcgtc tgaccgggcg acccgagcag caggtccgac tcgtcgaggc ttatgccaaa      1020
     gaacaaggaa tgtggcacga ccccgatcaa gaaccggcct acagtcacac cgtcgagctc      1080
     gacctcgcca ccgtcgagcc gtccatcgcg ggcccgaaac gaccccagga ccgcatcccg      1140
     ctggccagtg cgccgcacgc cgttgggtcg ttgctggcgg gccaaccatt gccgactgcg      1200
     ctggatgccg gcctcgacga ggcgtccggc gagtcgttcc ccgccagcga tccgatcgcg      1260
     gtcgaccacg accgcgcatc ggatgggccg gcggcgccgt gccggtgcgg gaagagccat      1320
     gtatggccct ccgacccggt ggaggtggtc ctcgacggcg aggtgcacag tgtcgatcac      1380
     gggcatgtgg tcatcgccgc gattacctcg tgcaccaaca cctcgaaccc gtcggtgatg      1440
     atcggcgcgg gcctgctggc gaagaaggcc gtgcaggcgg gcctgactcg taaaccgtgg      1500
     gtgaagacgt cgctggcccc gggatcgcgg gtggtcaccg actactacga tcgggccggg      1560
     ctgaccccct atctggaacg gctgggcttc ggactcgttg gctatggctg taccacctgc      1620
     atcggtaatt ccggtccgct gatctcccag gtcagcgacg cggtcaccgg acacgatctg      1680
     accgcctgcg cggtgctgtc cgggaaccgt aacttcgagg gccgtatcca cgccgagtgc      1740
     aagatgaact tcctcacctc cccgccgctg gtcatcacct acgcactcgc cgggaccatg      1800
     ctcgccgatg tgctgcatga tccgatcggg accgggtcgg acgggcggcc ggtgtatttg      1860
     cgcgacatct ggccgagcac cgaggaggtc aaggcagtca tcgacgaatg cctgcagtca      1920
     cagatgttca ccgacggcta ctcgaatgtg ttcgccggcg acgacaactg gcgcggcctc      1980
     gatgtcgcct ccggtgagat attcgaatgg cacgaggact ccacctatgt gcggcggcca      2040
     ccgtacttcg acggcataca gcccgaaccg caaccgatct ccgacatcac cggcgcccgg      2100
     gtgttggtca tgttggggga ttcggtgacc accgaccaca tctcacccgc gggcacgatc      2160
     cgccgcggca gcccggccgg tatctacctg cgcgagcatg gcgtcgaacc gcccgacttc      2220
     aactcctacg gatcccgtcg cggcaaccac gaggtgatga tccgcggcac cttcgccaac      2280
     attcgcctgc ggaatctgct ggccccgggc acggagggcg gcgtcacccg ccacctcccc      2340
     gacgggcagg agatgagcat cttccacgcc gcgaacgcct acgccgccga gggcactgcg      2400
     ctgatcatcc tcgccggcgc cgagtacgga tctgggtcct cgcgcgactg ggcggccaag      2460
     ggaacactgc tcctcggggt caaagcggtc ctcgcgacgt cgttcgagcg catccaccgc      2520
     tccaacctga tcggcatggg ggtactgccc ctgcaattcc cgcccggtca cacccgcgaa      2580
     agcctcggcc tgaccggtga agaggaatac tcgatcaccg gactcgaagg cggcgacccg      2640
     ggcgcggact tccctaccga ggtcaccgtc cgagcccacc accatggtca agtacaggaa      2700
     ttccgcgcca ccgtgcggat cgataccccc gcggaggcgg gatacttccg ccacggcggg      2760
     atactgcaat atgtgctgcg acagctcctc gtcacctga                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page