(data stored in ACNUC7421 zone)

EMBL: AP011115.ARC

AP011115.ARC         Location/Qualifiers
FT   CDS_pept        complement(604420..606195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arc"
FT                   /locus_tag="ROP_05870"
FT                   /product="ATPase ARC"
FT                   /EC_number="3.6.-.-"
FT                   /note="protein synonym:AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48834"
FT                   /db_xref="GOA:C1ASQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASQ2"
FT                   /protein_id="BAH48834.1"
FT                   /translation="MSSTENPDSVAAARELEALRAEASALRRQLAESPEQLREMESRVD
FT                   SLSIRNTKLMDTLKEARQQLIALREEVDRLGQPPSGYGVLLGVHDDQTVDVFTSGRKMR
FT                   LTCSPNVDAETLKLGQTVRLNEALTIVEAGNFERVGEISTLREVLDDGQRALVVGHADE
FT                   ERIVWLAEPLATVFEESERESVAYDAESPTRKLRPGDSLLVDTKAGYAFERIPKAEVED
FT                   LVLEEVPDVHYDDIGGLGRQIEQIRDAVELPFLHKDLFHEYELRPPKGVLLYGPPGCGK
FT                   TLIAKAVANSLAKKIAEARGQDSKEAKSYFLNIKGPELLNKFVGETERHIRLIFQRARE
FT                   KASEGTPVIVFFDEMDSIFRTRGSGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNR
FT                   EDMIDPAILRPGRLDVKIKIERPDAESAQDIFSKYLVETLPVHSDDLAEFGGDRTACIR
FT                   VMIERVVDRMYAESEENRFLEVTYANGDKEVLYFKDFNSGAMIQNIVDRAKKYAIKSVL
FT                   DTGAPGLRVQHLFDSIVDEFSENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKNAS
FT                   ASRAIDTESNTGQYL"
     atgagctcga cagagaaccc cgattcggtt gcggccgcac gagagctcga ggcgttgcgc        60
     gcagaggcgt cggcactgcg taggcagctc gcggagtcgc cggaacagct tcgtgagatg       120
     gaatcgcgag tggactcgct gtccatccgg aacaccaagc tgatggacac cctcaaggag       180
     gcccgtcagc agctcattgc gcttcgagag gaagtcgatc gcctcggcca gccgccgagc       240
     gggtacggcg tgctgctcgg agtgcacgac gatcagaccg tggacgtgtt cacctccgga       300
     cgcaagatgc ggttgacctg ctccccgaac gtcgacgccg agactctcaa gctcggtcag       360
     accgtgcgtc tcaacgaggc actcacgatc gtggaagcgg gcaacttcga gcgcgtcggt       420
     gagatcagca cgctgcgcga ggtcctcgac gacggtcagc gcgctctcgt ggtcggtcac       480
     gccgacgagg aacggatcgt ctggctggcc gaacccctcg ccaccgtctt cgaggagagc       540
     gagagggagt cggtcgcgta cgacgccgaa tcgcccaccc gcaaactgcg gccgggcgac       600
     tccctcctcg tcgacacgaa ggccgggtac gcgttcgagc ggatccccaa ggccgaggtc       660
     gaggatctcg tcctcgaaga ggttcccgac gtccactacg acgacatcgg cggtctcggc       720
     cggcagatcg agcagatccg cgacgccgtc gagctgccct tccttcacaa ggacctgttc       780
     cacgaatacg agctccgccc gccgaagggc gtgctcctct acggtccgcc cgggtgcggc       840
     aagacgctca tcgccaaggc ggtcgccaac tcgctcgcga agaagatcgc ggaggcccgg       900
     gggcaggaca gcaaggaagc caagtcctac ttcctcaaca tcaagggccc cgagctgctg       960
     aacaagttcg tcggcgagac cgagcggcac atccggctga tcttccagcg ggcccgggag      1020
     aaggcgtccg agggcacccc ggtgatcgtg ttcttcgacg agatggattc catcttccgc      1080
     acccgcggat cgggtgtctc ctccgacgtc gagaccaccg tggtgcctca gctgctcagt      1140
     gagatcgacg gtgtggaggg actcgagaac gtcatcgtga tcggcgcctc caaccgcgag      1200
     gacatgatcg accccgcgat cctgcgcccc ggccgcctcg acgtgaagat caagatcgag      1260
     cgccccgacg cggagtcggc gcaggacatc ttctcgaagt acctcgtcga gacgctgccg      1320
     gtgcacagcg acgacctcgc ggagttcggt ggcgaccgca cggcctgcat ccgggtgatg      1380
     atcgaacggg tcgtcgaccg catgtacgcc gagagcgagg agaaccgctt cctcgaggtc      1440
     acgtacgcca acggcgacaa ggaggtcctg tacttcaagg acttcaactc gggggcgatg      1500
     attcagaaca tcgtcgaccg cgccaagaag tacgcgatca agtcggtgct cgacaccggt      1560
     gccccgggcc tgcgcgtcca gcacctgttc gactccatcg tcgacgagtt ctcggagaac      1620
     gaggacctgc cgaacaccac caaccccgac gactgggccc ggatctcggg taagaagggt      1680
     gagcggatcg tctacatccg cacgctggtc accggtaaga acgcgagcgc cagccgcgcc      1740
     atcgacaccg agtccaacac cggccagtac ctgtag                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page