(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGB

AP011115.ARGB        Location/Qualifiers
FT   CDS_pept        complement(715040..715966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ROP_06850"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="protein synonym:N-acetyl-L-glutamate
FT                   5-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48932"
FT                   /db_xref="GOA:C1AT00"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT00"
FT                   /protein_id="BAH48932.1"
FT                   /translation="MTAASEALTGITDHQKAHVLAEALPWLQQFRDKVVVVKYGGNAMV
FT                   DDALKTAFAADMAFLRTVGIQPVVVHGGGPQINAMLGKLGMTGEFKGGFRVTTPEVMDV
FT                   VRMVLFGQVGRELVGLINAHGPYAVGISGEDAHLFTATKRTVMVEGTPTDIGLVGDVTT
FT                   VNPEAVLDLIRAGRIPVVSTIAPDSDGVVHNINADTAAAALAEAIGAEKLVVLTDVEGL
FT                   YTNWPDRDSLATEIDVDALAQLLPSLDAGMVPKMEACLRAVRGGVPTAHVIDGRLAHSV
FT                   LLELFTGEGIGTMVTPAPTSPTEGVAP"
     atgacagcgg ccagcgaagc gctcaccggc atcaccgatc accagaaggc tcatgtcctg        60
     gcggaggcac tgccgtggct gcagcagttc cgcgacaagg tcgtcgtcgt gaagtacggc       120
     ggcaacgcca tggtcgacga cgcgctgaag acggcgttcg ctgccgacat ggcgttcctg       180
     cggaccgtcg gaattcagcc ggtcgtcgtg cacggcggcg gtccccagat caacgccatg       240
     ctcggaaagc tcggcatgac aggtgaattc aagggcggat tccgcgtcac cacccccgag       300
     gtgatggacg tcgtccggat ggtgctgttc ggtcaggtcg gccgcgaact cgtcgggctg       360
     atcaacgccc acgggccgta cgccgtcggg atctccggtg aggatgcaca cctgttcacc       420
     gccaccaagc gcaccgtgat ggtcgagggc acgccgacgg acatcggact cgtcggcgac       480
     gtcacgaccg tgaacccgga ggccgttctc gacctcatcc gcgcgggccg aattcccgtg       540
     gtgtccacca tcgcccccga ctcggacggt gtggtgcaca acatcaacgc ggacaccgcc       600
     gccgcggcgc tcgccgaggc catcggtgcc gagaagctcg tggtcctcac ggatgtcgaa       660
     gggctgtaca cgaactggcc ggaccgcgat tcgctggcca ccgagatcga cgtcgacgcg       720
     ctcgcgcaac tgctgccgag tctcgatgcc ggcatggtgc ccaagatgga ggcctgcctg       780
     cgcgcggtcc gcggcggggt acccaccgcg cacgtcatcg acggccgcct cgcgcattcc       840
     gttctgctcg aactgttcac cggcgagggc atcggcacga tggtcacgcc cgccccgact       900
     tcacctaccg agggagttgc cccatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page