(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGC

AP011115.ARGC        Location/Qualifiers
FT   CDS_pept        complement(717204..718259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ROP_06870"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="protein synonym:N-acetyl-glutamate semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48934"
FT                   /db_xref="GOA:C1AT02"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT02"
FT                   /protein_id="BAH48934.1"
FT                   /translation="MTEHAGKPIRIAVAGASGYAGGEVLRLLLGHPSYADGSLVIGALT
FT                   AGGNAGSTLGSHHPHLLPLADRVLEDTTVDTLSGHDVVFLGLPHGNSAQYAKDLPESTV
FT                   IIDCGADFRLTNAEDWERYYKSPHAGSWPYGLPELPGAREKLAGATRIAVPGCFPTVSS
FT                   LAMAPAVAAGVVEPRVTIVAVTGASGAGRAPKADLLGSEVMGSVRAYGVGGVHRHTPEI
FT                   IQNLSELAGERVTVSFTPVLAPMPRGILATCTAVTTATEDEVRAIYEKAYADEPFVHVL
FT                   PRGVLPQTGAVVGSNAVQIAVAVDADAGQIVVVAVIDNLAKGTAGGAVQSMNLALGLPE
FT                   TAGLSTVGVAP"
     atgactgagc acgcgggaaa accgatcagg attgccgtcg ccggcgcgag cggatacgcc        60
     ggtggcgaag tgctgcgtct gctgctgggg cacccgtcgt atgcggacgg ttcgctcgtc       120
     atcggcgcgc tcaccgccgg cggcaacgcc ggttcgactc tgggctcgca ccatccgcac       180
     ctgcttcccc tcgccgaccg agtgctggaa gacaccaccg tcgacacact ctccggtcac       240
     gatgtggtgt tcctcggtct gccgcacggc aattcggcgc agtacgcgaa ggacctgccc       300
     gagtccacgg tcatcatcga ctgcggcgcc gacttccggc tgacgaacgc cgaggactgg       360
     gagcggtact acaagagtcc gcacgcgggt agctggccgt acggtctccc ggaactcccc       420
     ggcgcccgcg agaaattggc gggtgccacc cgcatcgcgg tcccgggatg cttcccgacg       480
     gtgtcgagcc tggcgatggc ccccgcggtc gcggcgggcg tcgtcgaacc gcgggtgacg       540
     atcgtcgcgg tcaccggcgc ttccggcgcg ggacgcgctc ccaaggccga cctgctcggc       600
     tccgaggtga tgggttcggt ccgcgcgtac ggcgtcggcg gcgtgcaccg ccacacgccg       660
     gagatcatcc agaacctctc cgaactcgcc ggcgagcgcg tcaccgtatc gttcacgccc       720
     gtgctcgcgc cgatgccgcg tggcatcctc gccacctgca ccgcggtcac cacggcaacc       780
     gaggacgagg tgcgcgcgat ctacgaaaag gcttacgcgg acgagccgtt cgtgcacgtg       840
     ctgccccggg gcgtgctgcc gcagaccggg gcggtcgtcg gatcgaacgc cgtccagatc       900
     gccgtggcgg tcgacgccga cgccggccag atcgtcgtgg tcgcggtgat cgacaacctc       960
     gcgaagggca ccgccggggg agcggtgcaa tcgatgaatc ttgcgcttgg actacccgag      1020
     accgccggtc tctcgacagt gggagttgcc ccgtga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page