(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGG

AP011115.ARGG        Location/Qualifiers
FT   CDS_pept        complement(711120..712319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="ROP_06810"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="protein synonym:citrulline--aspartate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48928"
FT                   /db_xref="GOA:C1ASZ6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ6"
FT                   /protein_id="BAH48928.1"
FT                   /translation="MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDME
FT                   VVRQRALDCGAVESVVVDARDEFADEYCLPTIQANALYMDRYPLVSAISRPLIVKHLVE
FT                   AARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLDVIAPVRDYAWTREKAIAFAEENE
FT                   IPINVSKKSPFSIDQNVWGRAVETGFLEDLWNAPTKDVYDYTQDPTVNWQAPDELIISF
FT                   EAGRPVAIDGKPVSVLEAIQELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLI
FT                   NAHQELEHVTQERELGRYKRQTEQRWSELVYDGLWFSPLKVALDTFIEKTQERVSGDIR
FT                   LVLHGGAIIVNGRRSNESLYDFNLATYDEGDTFDQSYAKGFVQIHGLSSKVAAKRDLGL
FT                   "
     atggccgatc gcgtcgtact cgcctactcg ggcgggctgg acacctcagt cgccatcagc        60
     tggatcggca aggagaccgg caaggaagtt gttgctgtcg ccatcgatct cggccagggc       120
     ggcgaggaca tggaggtcgt gcgccagcgt gcactcgact gcggtgcggt cgaatcggtc       180
     gtggtggacg cgcgcgacga attcgccgac gaatactgcc tgccgaccat ccaggccaac       240
     gccctgtaca tggaccgcta cccgctcgtg tcggccatca gccgcccgct gatcgtcaag       300
     cacctcgtcg aggccgcacg tgcccacggc ggcaccacgg tcgcgcacgg ctgcaccggc       360
     aagggcaacg accaggtccg gttcgaggtg ggcttcggat cgctcgctcc cgacctcgac       420
     gtgatcgcac cggtccgcga ctacgcgtgg acccgggaga aggcgatcgc attcgccgag       480
     gagaacgaga tcccgatcaa cgtctccaag aagtcgccgt tctcgatcga ccagaacgtc       540
     tggggccgcg ccgtcgagac cgggttcctc gaggacctgt ggaacgcgcc gaccaaggac       600
     gtctacgact acacgcagga tccgaccgtc aactggcagg ccccggacga gctgatcatc       660
     agcttcgagg ccggacgccc cgtcgcgatc gacggcaagc cggtcagcgt cctcgaagcg       720
     atccaggagc tcaaccgccg tgcaggcgct cagggtgtcg gccgcctcga cgtcgtcgag       780
     gaccgtctcg tcggcatcaa gagccgggag atctacgagg cgcccggcgc catggtgctc       840
     atcaacgcgc accaggaact cgagcacgtc acgcaggaac gcgagctcgg tcggtacaag       900
     cgtcagaccg agcagcgctg gagcgagctg gtgtacgacg gcctgtggtt ctccccgctg       960
     aaggtcgcgc tggacacgtt catcgagaag acgcaggaac gcgtctccgg cgacatccgg      1020
     ctggtgctgc acggtggggc gatcatcgtc aacggccgcc gcagcaacga gtcgctgtac      1080
     gacttcaacc tggccaccta cgacgagggc gacacgttcg accagtccta cgccaagggg      1140
     ttcgtgcaga ttcacggact gtcgtcgaag gtcgcggcga agcgcgacct gggcctctag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page