(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGH

AP011115.ARGH        Location/Qualifiers
FT   CDS_pept        complement(709699..711117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="ROP_06800"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="protein synonym:arginosuccinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48927"
FT                   /db_xref="GOA:C1ASZ5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ5"
FT                   /protein_id="BAH48927.1"
FT                   /translation="MSAHGTNEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRAS
FT                   QAHARVLHKAGLLGDEDLATMLDGLGRLAADVASGDFIPSESDEDVHGALERGLIDRVG
FT                   PDVGGRLRAGRSRNDQVATLFRMWLRDAVRRVAEGVLDIVDALATQAAAHPSAVMPGKT
FT                   HLQAAQPVLLAHHLLAHTHPLLRDVQRLRDFDVRAAVSPYGSGALAGSSLGLDPEAIAA
FT                   ELAFDSSAENSIDATSSRDFAAEAAFVLAMIGVDLSRMAEEVILWSTPEFGYITLADAW
FT                   STGSSIMPQKKNPDVSELTRGKSGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSV
FT                   AQLELLLPAITGLVATLEFHTDRMAELAPAGFTLATDIAEWLVRQGVPFRVAHEAAGAC
FT                   VRVAEARGAGLEDLTDEELAGVDPALTPDVREVLTVEGSIASRNARGGTAGIRVAEQLG
FT                   GVRQLSESLREWCR"
     atgagtgctc acggcaccaa cgaaggagcg ctgtggggcg gacggttcga gtccggaccg        60
     gccgccgcca tggcggcgct gagcaagtcc acccatttcg actgggtgct ggccccgtac       120
     gacgtgcgcg catcccaggc gcacgcccgg gtgctgcaca aggccggcct gctcggtgac       180
     gaagacctgg cgacgatgct cgacggtctc ggcaggctcg cggccgacgt cgcgagcggc       240
     gacttcatcc cgagcgaatc cgacgaggac gtgcacgggg ccctcgagcg tgggctcatc       300
     gatcgggtcg gtcccgacgt cgggggtcgc ctgcgcgccg ggcgttcgcg caacgatcag       360
     gtggcgacgc tgttccggat gtggctgcgg gacgcggtcc gccgcgtcgc cgagggggtc       420
     ctcgacatcg tcgacgccct cgcgacgcag gccgccgcgc acccgtccgc ggtgatgccg       480
     ggcaagactc acctgcaggc cgcgcagccg gttctgctcg cccaccattt gctggcacac       540
     acgcatccgt tgctccgcga cgttcagcgg ctgcgggact tcgacgtgcg ggcggccgtg       600
     tcgccgtacg gttccggggc gctggccgga tcgtcactcg gactcgatcc ggaggcgatc       660
     gccgcggaac tcgcgttcga ttcgtccgcg gagaactcga tcgacgccac ctcgtcgcgg       720
     gatttcgcgg ccgaggctgc gttcgtgctc gcgatgatcg gcgtcgacct gtcgcggatg       780
     gccgaggagg tcatcctgtg gagcactccg gaattcggct acatcacact cgccgacgcc       840
     tggtcgacgg gctcgtcgat catgccgcag aagaagaacc cggacgtgtc cgagctgacc       900
     cgcggcaagt cgggccggtt gatcggcaat ctgaccggac tgctggcgac cctgaaggcg       960
     cagccgctcg cgtacaaccg ggatctgcag gaggacaagg agccggtctt cgattcggtg      1020
     gcgcagctcg agttgcttct gcctgcgatc accggactgg tcgccactct cgaattccac      1080
     acggatcgaa tggcggaact ggctccggcg ggtttcacgc tggccaccga catcgccgag      1140
     tggctcgtcc gccagggcgt cccgttccgc gtcgcgcacg aggccgcggg ggcctgcgtc      1200
     cgcgtcgccg aggcgcgggg tgccggactc gaggatctca ccgacgagga actcgccggg      1260
     gtcgatccgg ctctcactcc ggacgtgcgg gaggtgctca ccgtcgaggg ctcgatcgcc      1320
     tcgcgtaacg ctcgcggcgg tacggccggt atccgtgtgg ccgaacagct gggcggggtc      1380
     cgtcagctgt cggagtcgct gcgcgaatgg tgtcggtga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page