(data stored in ACNUC7421 zone)

EMBL: AP011115.ARGJ

AP011115.ARGJ        Location/Qualifiers
FT   CDS_pept        complement(715963..717207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="ROP_06860"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:arginine biosynthesis bifunctional
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48933"
FT                   /db_xref="GOA:C1AT01"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT01"
FT                   /protein_id="BAH48933.1"
FT                   /translation="MSSDSTIDPHPAREVAGGTLVRSQGVSGPAGFRASGIKAGIKASG
FT                   NADLALVVNEGPELAAAGVFTANKVKAAPVLWSQQVLTTGRLRAVVLNSGGANACTGAG
FT                   GFQDAHKTAEEVASALSNWGTETGAVEVAVCSTGLIGDRLPMDKVLTGVTEAVHELAGG
FT                   ISGGTDAAYAIMTTDTVPKQAALHHAGKWNVGGMAKGAGMLAPALATMLCVVTTDAVAT
FT                   ASQLDAALRAATRVTFDRLDVDGATSTNDTVLLLASGASNVTPTQEELNAAVTAVCDDL
FT                   ADQMMADAEGVTKRVRVTVSGAVSEHDALIGARTVARDSLVKTALFGSDPNWGRVLAAI
FT                   GIAPIELDPDKISVSFNGAPVCIDGVGAPGARDVDLSEVDIALDIDLGLGEHAVTIRTT
FT                   DLSHAYVEENSAYSS"
     gtgagcagtg acagcacgat cgatccgcac ccggcccggg aagtcgccgg cggcaccctc        60
     gtccgcagcc agggagtgtc ggggcccgcg ggcttccgcg cgtccgggat caaggcggga       120
     atcaaggcga gcggcaacgc cgacctggcc ctcgtcgtca acgagggccc ggaactcgcg       180
     gcggcgggtg tcttcaccgc gaacaaggtg aaggcagccc cggtgctgtg gtcgcagcag       240
     gtgctgacca cgggcagact gcgcgccgtc gtgctcaact cgggtggtgc caacgcgtgc       300
     acaggggcgg gaggattcca ggacgcgcac aagacggccg aggaagtggc gtcggcgctg       360
     agcaactggg gcaccgagac cggtgccgtc gaggtcgcgg tgtgttccac cggtctgatc       420
     ggcgaccgcc tgccgatgga caaggttctg accggcgtca cggaggccgt ccacgaactc       480
     gcaggcggaa tctcgggtgg caccgacgcg gcgtacgcga tcatgaccac cgacacggtg       540
     ccgaagcagg cggccctgca ccacgcgggc aagtggaacg tgggcgggat ggcgaagggc       600
     gccggcatgc tggcgccggc gctggcgacg atgctgtgcg tcgtgaccac cgacgccgtc       660
     gcgacggcgt cgcaactcga cgcggccctg cgggcggcca cccgggtgac gttcgaccgg       720
     ctcgacgtcg acggcgccac ctcgaccaac gacaccgtgt tgctgctcgc gtccggtgcg       780
     agcaacgtga cccccaccca ggaagaattg aacgcggccg tgacggccgt ctgcgacgac       840
     ctggccgatc agatgatggc ggacgcagag ggcgtcacca agcgggtgcg agtcaccgtc       900
     agcggcgcgg tcagcgagca cgacgcgctg atcggggccc ggacggtggc gcgtgacagc       960
     ctcgtcaaga ctgcgctgtt cggttccgac cccaactggg gccgggtcct cgccgcgatc      1020
     ggcatcgcgc cgatcgaact cgaccccgac aagatctcgg tgtcgttcaa cggcgccccg      1080
     gtctgcatcg acggcgtcgg cgccccgggc gcgcgggacg tggacctgag cgaagtcgac      1140
     atcgccctcg acatcgatct gggtctgggc gagcacgcgg tgaccatccg gaccaccgac      1200
     ctttcgcacg cgtatgtcga agagaactcg gcgtattcgt catga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page