(data stored in ACNUC7421 zone)

EMBL: AP011115.CMK

AP011115.CMK         Location/Qualifiers
FT   CDS_pept        complement(681157..681846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="ROP_06580"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="protein synonym:CMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48905"
FT                   /db_xref="GOA:C1ASX3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX3"
FT                   /protein_id="BAH48905.1"
FT                   /translation="MSTSSLIVAMDGPSGTGKSSVSRMLARRLGARYLDTGAMYRIATL
FT                   HVLRKGVDLADPDAIADATVGLPWSIGTDPAGEQVLLDGEDVGEEIRGDAVTKAVSAVS
FT                   AVPAVRELLVAAQRRLACEAGRIVVEGRDIGTVVLPDADVKIYLTASAEARAQRRNAQN
FT                   LAEGRGDDFAAVLADVQRRDHLDSTRAVSPLRPADDSVLVDTSELGIDDVIGRLLLVVS
FT                   ERSGVGQ"
     gtgagtacct cgtcgttgat cgtcgcgatg gacggcccgt ccggaaccgg gaagtcgagc        60
     gtctcgcgga tgctggcgcg gcggctcggc gcccgctacc tcgacaccgg agccatgtac       120
     cggatcgcga cgctgcatgt gctgcggaag ggtgtggatc tcgccgaccc cgacgcgatc       180
     gccgacgcga ccgtcggttt gccctggtcg atcggaaccg acccggcggg cgagcaggtt       240
     ctgctcgacg gcgaggacgt gggggaggag atccgcggcg acgcggtgac caaggccgtc       300
     tccgccgtct ccgccgttcc cgcggtgcgt gaactgctcg tcgcggcgca gcgtcgcctt       360
     gcttgcgagg ccggacggat cgtcgtcgag ggccgggaca tcggcaccgt cgtgcttccc       420
     gatgccgatg tgaagatcta cctgaccgcc tcggcagaag cccgggcgca gcgcagaaat       480
     gcgcagaatc tcgcggaagg acgaggcgac gacttcgcgg ccgtgctggc cgatgtgcag       540
     cgtcgtgacc acctcgactc cacgcgcgcc gtgtcgccgc tgcggccggc cgacgattcc       600
     gtgctggtcg acaccagcga actcggaatc gacgacgtga tcggcaggtt gctgctggtg       660
     gtaagcgaaa gaagtggagt agggcagtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page