(data stored in ACNUC7421 zone)

EMBL: AP011115.COAE

AP011115.COAE        Location/Qualifiers
FT   CDS_pept        complement(739311..740525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ROP_07070"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="protein synonym:dephosphocoenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48954"
FT                   /db_xref="GOA:C1AT22"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT22"
FT                   /protein_id="BAH48954.1"
FT                   /translation="MLRIGLTGGIGAGKSTVSKVLAELGAVIVDADLIAREVVEPGTQG
FT                   LAALVDRFGEEILTADGALDRPALAARAFADEESRLALNSIVHPLVGARTTETIESAPE
FT                   DAVLVQDIPLLVEGGMGAAFHLVVVVFVDAEDRVRRLVGSRGMSESDARARIAAQADDD
FT                   QRRAAADVRLDNSGAPGALEPEVRALWAERLVPFESNIRTRTVVRVLPELASPNPQWPA
FT                   QADRLIARLRLVCGDRAVRIDHIGSTAVEGLPAKDVIDVQVTVANLEVADELAESLAAA
FT                   GFPRIEHITADDPKPAYQGGETDPALWGKRIHGGADPGRPVNIHLRVDGWPGQQFALVF
FT                   RDWLRADTDARAEYLAVKEAAAEKAAGHADYQDAITAYVDAKTPWFDRAYHRAWQWAEQ
FT                   TGWSA"
     gtgttgagaa tcggcctcac tggaggcata ggagccggta agtccaccgt gtcgaaggtc        60
     ctcgccgaac tcggggcggt gatcgtcgac gccgatctga tcgcgcggga ggtcgtcgaa       120
     cccggaacgc aaggcctcgc tgctctcgtc gaccggttcg gcgaggagat cctgacggcg       180
     gacggcgcgc tcgaccggcc cgccctggca gcgcgcgcct tcgccgacga agaatcgcgg       240
     ctggcgctga attcaatcgt ccacccgctg gtcggggcgc gtaccaccga gacgatcgag       300
     tcggcgccgg aggacgcggt gctcgttcag gacattccgt tgctggtcga gggtggaatg       360
     ggggccgcgt tccatctggt cgtcgtcgtg ttcgtcgatg ccgaggaccg ggtgcggcgg       420
     ctcgtcggat cgcggggaat gtccgagtcc gacgcgcgtg cacggatcgc cgctcaggcg       480
     gacgacgatc agcggcgggc ggcggccgac gttcggctcg acaacagcgg cgccccgggc       540
     gcgctcgagc cggaggtccg ggcgttgtgg gccgagcgtc tggtgccgtt cgagtccaac       600
     atccgcacgc ggaccgtcgt gcgggtgctg cccgaactcg cctcgccgaa tccgcagtgg       660
     ccggcccagg ccgaccggct gatcgcccgg ttgcggctgg tgtgcggcga ccgtgccgtc       720
     cggatcgacc acatcgggtc gacggccgtg gaggggctgc ctgccaagga cgtcatcgac       780
     gtccaggtga cggtggcgaa cctcgaggtc gcggacgaac tcgcggaatc actcgccgcc       840
     gccgggttcc cccgtatcga gcacatcacc gccgacgacc cgaagcccgc ataccagggc       900
     ggcgagaccg atccggcgct gtggggcaaa cgaatccacg gcggcgccga tccggggcgg       960
     cccgtgaaca tccacctccg ggtcgacggg tggcccgggc agcagttcgc gctcgtgttc      1020
     cgggactggc tccgcgcgga caccgatgcg cgcgccgagt atctcgcggt caaggaggcc      1080
     gcggcggaga aggcggccgg tcacgccgac taccaggacg cgatcaccgc ctacgtcgac      1140
     gcgaagacgc cgtggttcga ccgcgcgtat caccgggcgt ggcagtgggc cgagcagacc      1200
     ggctggagcg catag                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page