(data stored in ACNUC7421 zone)

EMBL: AP011115.COBH

AP011115.COBH        Location/Qualifiers
FT   CDS_pept        313626..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="ROP_02930"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="protein synonym:precorrin isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48540"
FT                   /db_xref="GOA:C1AR63"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR63"
FT                   /protein_id="BAH48540.1"
FT                   /translation="MIEYIRDGAEIYRQSFATIRAEADLSAFPEDVSQAVVRMIHASGQ
FT                   VDLVDDVAFTPGVVKAARAALADGAPILCDAQMVAAGVTRKRLPADNEVICTLRDPRVP
FT                   VLAEQIGNTRSAAALELWGGKLEGAVVAIGNAPTALFYLLDMIESGAPRPAAIVGGPVG
FT                   FIGAAESKEALIEHPSGLDYLVVRGRRGGSAITAAALNAIASEVE"
     atgatcgagt acatccgaga cggcgcggag atctaccgcc agtccttcgc cacgatccgc        60
     gccgaggcgg atctcagtgc ctttcccgag gacgtctcac aggccgtggt ccgcatgatc       120
     cacgcgagcg gtcaggtcga tctcgtggac gacgtcgcgt tcacccccgg cgtcgtgaag       180
     gccgcccgcg cggcgctggc ggacggcgcc ccgatcctgt gcgacgcgca gatggtcgct       240
     gccggcgtga cccgcaagcg tcttccggcg gacaacgagg tgatctgcac cctgcgtgac       300
     ccccgggttc cggtgctggc ggagcagatc gggaacaccc gctcggcggc cgcgctcgaa       360
     ttgtggggcg gcaaactgga gggcgccgtc gtcgcgatcg gcaacgcccc gaccgccctg       420
     ttctacctgc tggacatgat cgaatccggt gcaccccggc ctgccgcgat cgtgggcggc       480
     ccggtcgggt tcatcggtgc ggcggagtcg aaggaagcgt tgatcgagca cccgagcgga       540
     ctcgactatc tggtggtccg cggccgccgc ggtggcagtg ccatcacggc tgcggcgctg       600
     aatgcgattg cgagcgaagt cgaatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page