(data stored in ACNUC7421 zone)

EMBL: AP011115.COBIJ

AP011115.COBIJ       Location/Qualifiers
FT   CDS_pept        314249..315751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobIJ"
FT                   /locus_tag="ROP_02940"
FT                   /product="precorrin-2 C(20)-methyltransferase/precorrin-3B
FT                   C(17)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /EC_number="2.1.1.131"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:cobalamin biosynthesis protein
FT                   CobIJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48541"
FT                   /db_xref="GOA:C1AR64"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR64"
FT                   /protein_id="BAH48541.1"
FT                   /translation="MSSEERSTGKLWGVGIGPGDPELVTVKAARIITEADVVAFHSARH
FT                   GKSISRAVAAPYLRDGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLEAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLAQRFEAEVIPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTLPRGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   HADDVSDSDVPYFSIAIVPSPSNARREDAPPQGELVVVGLGPGDQSWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGARVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGPQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
     atgagttccg aagagcggtc gaccggcaag ctgtggggcg tcggcatcgg tccgggcgac        60
     ccggaactgg tgacggtcaa ggccgcgcgg atcatcaccg aggccgacgt ggtggcgttc       120
     cacagcgccc ggcacggcaa gagcatctcc cgcgcggtcg cggcgccgta cctgcgtgac       180
     ggccagatcg aggagcacct cgtctacccg gtcaccaccg agaccgtcga ccacccgggc       240
     ggataccagg gggcgatgga cgagttctac gaggaagcgt cgcagcggct cgccgcgcac       300
     ctcgaggccg ggcgctcggt ggcgctcctc gcggccggcg atccgctgtt ttacagctcc       360
     tacatgcaca tgcacaagcg gctggcgcag cgcttcgagg cggaggtcat tcccggggtg       420
     acgtcgatca gcgccgcctc ggccgcgctg gcgatgccgc tcgtcgaggg cgaggaaatc       480
     ctcaccgtcc tgcccggaac cctgccgcgc ggtgagctga cgcggcgcct gcgcgagacc       540
     gacgccgccg ccatcctgaa actcggacgc acctacccgg ccgtgcggca ggcgttgaag       600
     gattccggtc gcatcgacga gacgtggtac gtcgagcggg ccagcacgac ccggcagaag       660
     atcgaccacg cggacgacgt gtcggacagc gacgtcccct acttctcgat cgccatcgtg       720
     cccagtccgt cgaacgcccg gcgcgaggac gcgccgccgc agggcgaact cgtcgtcgtc       780
     ggcctcggcc ccggcgatca gtcctggacg accccggaag tacagcacga actgtctctc       840
     gccaccgacc tcgtcggcta cgggccgtac atcgaccggg tccccgagcg tccgggccag       900
     cgtcggcact ccagcgacaa ccgggtcgag gccgaacggg ccgcgatggc gctcgacctc       960
     gcgaagaacg gggcccgcgt cgccgtcgtg tcctcgggcg acccgggcgt gttcgcgatg      1020
     gccgccgccg tgctggaagt ggccgccgag gagcagtggc ggggcgtgcc cgtccgcgta      1080
     ctgcccggca tgaccgccgc gaacgccgtg gcgagccggg tcggggcacc cctcgggcac      1140
     gactacgccg tgctgtcgct gtccgatcgg ctcaagccgt gggacgttgt ggcgcagcgt      1200
     atttcggcgg tcgcgagcgc cgacatggcc ttcgccgtct acaacccggc gtcgaagtcg      1260
     cgcacctggc aggtcgccgc gatgcgcgac ctcgttctcg agcaccgctc ccccgacacc      1320
     ccggtgatca tcggccggga tgtggcgggc ccgcaggagt cggtgcgggt cgtgcggctc      1380
     gcggacctcg acccggccga gatcgacatg cgctgcctgc tcatcgtggg ctcctccatg      1440
     acgaccgtcg tcgagaacga acacgggacc agggtcttca caccccggcg ctatccgggc      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page