(data stored in ACNUC7421 zone)

EMBL: AP011115.COBK

AP011115.COBK        Location/Qualifiers
FT   CDS_pept        complement(582605..583345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="ROP_05640"
FT                   /product="precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="protein synonym:precorrin-6A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48811"
FT                   /db_xref="GOA:C1ARY4"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY4"
FT                   /protein_id="BAH48811.1"
FT                   /translation="MSRILILGGTGEARALAAALADVPGVEAVSSLAGRVRDPRLPAGE
FT                   VRIGGFGGAAGLAEWLCAHPVDAIVDATHPFAAQITRNAADAAHRRGIPLVVLRRPEWA
FT                   PRPGEHWHTAPDLARAADLLPGLGTRIFLTIGRQGVDVFAGLHALWFLIRAIDPPDVAM
FT                   PPQSTLLLARGPFAVAGETALMREHRIDVLVTKNSGGGQTDAKLDAARALGIPVLMIRR
FT                   PPLPSATATVDDVAGAVAWIGALA"
     gtgtcacgga ttctgatcct cggcggaacc ggggaggcgc gagcgctcgc cgcggcgctc        60
     gccgacgttc cgggtgtcga ggccgtgtcc tcactcgcgg gccgggtccg tgatccgcgc       120
     ctgcccgccg gtgaggtgcg gatcggcggg ttcgggggag cggccgggct tgcggagtgg       180
     ttgtgcgcgc atcccgtcga cgcgatcgtc gatgcgacgc acccgttcgc ggcacagatc       240
     acgcgcaacg ccgccgacgc cgcgcaccgt cgcggcatcc cgctcgtcgt tctccggcgc       300
     cccgaatggg cgccgcgtcc cggcgaacac tggcacaccg ccccggacct tgctcgcgcc       360
     gccgatctgc tacccggcct gggaacgaga atcttcctca ccatcggcag gcagggcgtc       420
     gatgtgttcg ccggcctgca cgcactgtgg ttcctgatcc gcgcgatcga tccacccgac       480
     gtggcgatgc cgccgcagtc gaccctgctc ctcgcccgcg ggccgttcgc ggtggccggc       540
     gagacggcat tgatgcgtga gcaccggatc gacgttctcg tgaccaagaa cagcggcggc       600
     ggtcagaccg acgcgaaact ggacgccgcg cgcgccctgg gcatcccggt gctgatgatt       660
     cgccgtccac cgttgccgtc ggcgacggca acggtcgacg acgtcgcggg agccgtcgcc       720
     tggatcggcg cgctcgcgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page