(data stored in ACNUC7421 zone)

EMBL: AP011115.COBL

AP011115.COBL        Location/Qualifiers
FT   CDS_pept        complement(584094..585329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="ROP_05660"
FT                   /product="precorrin-6Y C5,15-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /note="protein synonym:precorrin-6Y methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48813"
FT                   /db_xref="GOA:C1ARY6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY6"
FT                   /protein_id="BAH48813.1"
FT                   /translation="MTDPIVVVGIGADGWDGLSPSARREIEVADVVMGSGRQLALIPET
FT                   PALRVAWPSPLVPALPGLFEQHHGRRVCVLASGDPMFHGIGVTLVNLLGAERVRVIPHP
FT                   SSATLACARLGWAAHETPVISLVNRPVDALLPELADATRLLVLSRDEHTPAAVADLLTG
FT                   RGFGPSRLTVLGELGGPDESRLDGTASVWSHGPGPRLNVIAIDCRAESGAVRLTRLPGL
FT                   PDAAFTGDGQMTKHEIRALTLCALAPAAGELLWDVGGGSGTVAIEWMRTHPRCRAVTFE
FT                   RSAARVDQIEANASALGVPSLTVFGDAPAAFEDVPPASSVPDAIFVGGGVTQDGLLGEC
FT                   WSRLRVGGRMVANAVTAESEALLLQWFSKCGGQLRKFQVYRGEPLGGFTAWRPQLPVAQ
FT                   WSVTKQSKGDAA"
     atgaccgacc cgatcgtcgt cgtcgggatc ggtgccgacg ggtgggacgg tctgtcgccg        60
     tccgcgcggc gcgagatcga agtggccgac gtcgtgatgg gttcggggcg tcaactcgcc       120
     ctgatccccg agacgccggc gctgcgggtg gcctggccgt cgccgctggt cccggcgctg       180
     cccggcctgt tcgaacagca ccacggccgg cgggtgtgcg tgctggccag cggcgatccg       240
     atgttccacg ggatcggcgt caccctcgtg aacctgctcg gcgcggaacg ggtgcgggtg       300
     atcccgcatc cttcgtcggc caccctggcc tgcgcccgcc tgggttgggc ggcgcacgag       360
     acaccggtga tcagtctcgt gaatcgaccg gtcgacgcgc tcctgccgga actcgccgac       420
     gcgacgcgac tgcttgtgct gagccgggac gagcacactc ccgccgcagt ggccgacctg       480
     ctgacgggac gggggttcgg accgtcgcgg ctcaccgtgc tcggcgaact gggcggaccg       540
     gacgagtcga ggctcgacgg aacggcgtcg gtgtggtcgc acgggccggg accgcggctg       600
     aacgtgatcg cgatcgactg ccgggccgag tccggcgccg tccggctgac ccggctgccg       660
     ggactgcccg acgccgcgtt cacgggtgac gggcagatga ccaaacacga gatccgcgcg       720
     ctgacgctgt gcgccctcgc ccccgcggcg ggggagttgc tgtgggacgt gggcgggggg       780
     tccggcaccg tcgcgatcga atggatgcgc acccacccgc gctgccgggc agtgactttc       840
     gagcgcagcg cggcacgggt cgatcagatc gaggcgaacg cgtcggcgct cggggtgccg       900
     tccctcaccg tgttcggcga cgcacccgcc gcgttcgagg acgtaccacc cgcgtcgtcc       960
     gtgccggacg cgatcttcgt cggtggtggc gtcacccagg acggtctgct gggcgagtgc      1020
     tggtcccggc ttcgggtcgg gggccggatg gtggccaatg cggtgaccgc ggaatcggaa      1080
     gcgcttctgc tgcagtggtt ctcgaaatgc ggtgggcagc tccgcaaatt ccaggtgtac      1140
     cgaggggagc cactcggcgg attcaccgcg tggcggccgc aactgccggt ggcgcagtgg      1200
     tcggtgacga aacagtcgaa aggtgatgcg gcatga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page