(data stored in ACNUC7421 zone)

EMBL: AP011115.CTAD

AP011115.CTAD        Location/Qualifiers
FT   CDS_pept        72880..74625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="ROP_00830"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48330"
FT                   /db_xref="GOA:C1AS81"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS81"
FT                   /protein_id="BAH48330.1"
FT                   /translation="MTPLTVEVVPVRPFPARRGIKGSFLYKAATTTDPKMLGLMYMVTS
FT                   FVFFMVGGLMALLIRTELAVPGLQFLSNEQYNQLFTMHGTIMLLLYATPIVFGFANYIL
FT                   PLQIGAPDVAFPRLNALSYWLYLFGAIITVSGFLTPGGAADFGWTGYSPLTSAVHSPGV
FT                   GADVWITGLALAGVGTILGGVNMITTVICLRAPGMTMFRMPIFTWNIFITMILVLIAFP
FT                   ILAAALLGLLVDRHLGAHLFDPATGGALLWQHLFWFFGHPEVYIVAIPFFGIVSEIFPV
FT                   FSRKPLFGYTGLVYATIAIAALSTAVWAHHMFATGAVLLPFFSLMSFFIAVPTGVKFFN
FT                   WIGTMWKGQLTFETPMLFSIGFLVTFLFGGLSGVLLASPPLDFHVTDSYFLVAHFHYVL
FT                   FGTIVFATYAGIYFWFPKMTGRLMDERLGRWHFWTTFIGFHTTFLVQHWLGAEGMPRRY
FT                   ADYLPSDGFTTLNTVSTIGSFVLGGSVLPFVWNVFKSYRYGQVVTVDDPWGYGNSLEWA
FT                   TSCPPPRHNFTELPRIRSERPAFELHYPHMVKRMRAETYVGRRPKSVAVTAGTVSGPER
FT                   EAGRR"
     gtgactcccc tcaccgtgga agtcgttcct gtccggccgt tcccggcacg gcgcgggatc        60
     aaggggtcgt tcctctacaa ggccgccacc accaccgacc cgaagatgct gggtctgatg       120
     tacatggtca cctcgttcgt gttcttcatg gtcggcgggt tgatggccct gctgatccgc       180
     accgaactcg cggtccccgg tctgcagttc ctgtccaacg agcagtacaa ccagctgttc       240
     accatgcacg gcaccatcat gctgttgctg tacgcgacgc cgatcgtgtt cggtttcgcg       300
     aactacattc tgccgctgca gatcggcgcc cccgacgtgg cgttcccccg gctgaacgcg       360
     ctgagctact ggttgtacct gttcggcgcg atcatcaccg tgtccgggtt cctcaccccg       420
     ggaggggcgg cggacttcgg ctggaccggg tattcccccc tgaccagcgc ggtgcattcg       480
     ccgggggtgg gcgccgacgt gtggatcacg ggactggcgt tggccggtgt gggcaccatc       540
     ctcggcggcg tcaacatgat caccaccgtc atctgcctgc gggcgccggg gatgacgatg       600
     ttccggatgc cgatcttcac ctggaacatc ttcatcacca tgatcctggt gctgatcgcc       660
     ttcccgattc tggccgcggc actgttgggc ctgctcgtgg accggcacct cggggcgcac       720
     ctgttcgatc cggccaccgg cggtgccctg ctctggcagc acctgttctg gttcttcggt       780
     caccccgagg tgtacatcgt cgcgatcccg ttcttcggca tcgtctcgga gatcttcccg       840
     gtcttcagcc gcaagccgct cttcgggtac accggcctgg tctacgcgac catcgccatc       900
     gccgcactgt ccaccgcggt gtgggcgcac cacatgttcg ccaccggcgc cgttctgctg       960
     ccgttcttct cgctgatgag cttcttcatc gcggtgccca ccggggtgaa gttcttcaac      1020
     tggatcggca ccatgtggaa agggcaactc accttcgaaa ccccgatgct gttctcgatc      1080
     ggtttcctgg tgaccttcct gttcggtgga ctgtccggcg tgttgctcgc gagcccgccg      1140
     ctggacttcc acgtcaccga ctcctatttc ctcgtcgccc atttccacta cgtgctgttc      1200
     ggcaccatcg tgttcgccac ctacgccggc atctacttct ggttcccgaa gatgaccgga      1260
     cggctgatgg atgaacgcct cggcagatgg cacttctgga ccacgttcat cggctttcac      1320
     accaccttcc tggtccagca ctggctcggc gccgagggca tgccccgccg ctacgccgac      1380
     tacctcccct ccgacgggtt caccaccctc aacacggtct cgacgatcgg ctcgttcgtc      1440
     ctcggcgggt ccgtgttgcc gttcgtgtgg aatgtcttca agtcctaccg gtacggtcag      1500
     gtggtcacgg tcgatgaccc gtggggttac gggaactcgc tcgagtgggc caccagttgt      1560
     cccccgccgc ggcacaactt caccgagctg ccccgaatcc gttccgagcg tcccgcgttc      1620
     gagttgcact atccccacat ggtgaaacgg atgcgcgccg aaacgtacgt cggtcgacgg      1680
     cccaagtcgg tcgcggtcac cgcgggcacc gtctccgggc ccgagcgaga ggcgggccgg      1740
     cgatga                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page