(data stored in ACNUC7421 zone)

EMBL: AP011115.DEVS

AP011115.DEVS        Location/Qualifiers
FT   CDS_pept        168009..169739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devS"
FT                   /locus_tag="ROP_01930"
FT                   /product="two-component histidine kinase DevS"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48440"
FT                   /db_xref="GOA:C1ASJ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ1"
FT                   /protein_id="BAH48440.1"
FT                   /translation="MRRVTRLPDERDRGPLLGSLSELRLRELLTEVQDRIAQIVDVRDH
FT                   VDGLLEAMLAVTSGLDLDNTLRTIVHAAIDLVDARYGALGVLAPTEGLSEFVYEGIDQE
FT                   TRERIGDLPRGRGVLGFLITDPKPVRLVDLSRHPVSVGFPPDHPPMKTFLGVPIQVRDE
FT                   VFGNLYLTEKANGAQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIAT
FT                   ELLAGSETADVLQVIADDALALTAADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRI
FT                   IGRAIPVERSTSGEAFRERTPLRVSALAFDPGFETGARFGPALALPLRAAQSVSGVLVT
FT                   LRHVDASPFTDDQLALMSGFADQAAVALQLANSQRRMHELDVLSDRDRIARDLHDHVIQ
FT                   RLFAVGLSLQSTLQRAKAPVVKDRLEQSIDDLHDIVRDIRTAIFDLHGGSGGITQFRRR
FT                   LHEIVAETTADSGLRTTVHMSGPLSVIDATLAEHAEAVLREALSNAVRHAGADTVTVSI
FT                   SVYDDLAIEVADDGKGFEGSVLTSGLDNLAARAREVNGHCAVDSTLGGGTTLRWSAPLP
FT                   "
     atgcgtcgtg tgacccgtct accggacgag cgcgaccgag gacctctact cggtagcctg        60
     tccgagctca ggctgcgcga actcctgacc gaggtgcagg accgcatcgc gcagatcgtc       120
     gatgtgcgcg atcacgtcga cggcctgctc gaggcgatgc tcgcggtcac gtcagggctc       180
     gacctcgaca acacgctgcg caccatcgtg cacgccgcga tcgatctcgt cgacgcccga       240
     tacggtgcgc tgggggtcct cgccccgacc gagggactga gcgagttcgt ctacgagggc       300
     atcgaccagg agactcggga gcggatcggc gacctgcccc gcggccgcgg cgtcctcggt       360
     ttcctgatca cggatccgaa gccggtccgg ctggtggacc tgtcccggca tccggtgtcg       420
     gtgggattcc cgcccgacca tccgccgatg aaaacctttc tgggagttcc cattcaggtc       480
     cgtgacgagg tgttcgggaa tctgtatctc acggagaagg ccaacggtgc gcagttcacc       540
     gaggacgacg aggtgcttct gcgcgcgctg gcggccgccg ccggcatcgc gatcgagaac       600
     gcccgcctct acgaggagtc ccggacgagg caggcgtggc tggaggcgac ccgggagatc       660
     gcgactgaat tgctcgccgg cagcgagacg gcagacgtgc tgcaggtgat cgccgacgac       720
     gcgcttgccc tgaccgccgc cgacagtgcc tttctcgcgg tgccggacga tcccgacatc       780
     ccgtcggacg aggtcaccga gctcgtggtc acggcgtcgg cgggtacggt gtcggatcgg       840
     atcatcggcc gggcgatccc ggtcgagcgg tcgacgtccg gtgaggcgtt ccgggagcgg       900
     accccgctgc gcgtcagcgc gctggcgttc gatcccgggt tcgaaacggg cgcccggttc       960
     gggccggcgc tggcgctgcc cctgcgtgcc gcgcaatcgg tgtccggggt gctggtgacg      1020
     ctccgccacg tcgatgcatc accgttcacg gatgaccagc tggcgttgat gtcgggtttc      1080
     gcggatcagg ccgccgtcgc gttgcagctg gcgaacagtc agcgccggat gcatgagctc      1140
     gacgtcctgt ccgaccgcga ccggatcgcg cgtgatctcc acgaccacgt catccagcgg      1200
     ctcttcgcgg tcggcctgtc gttgcagagc accctgcagc gggcgaaggc acccgtcgtc      1260
     aaggaccgac tcgaacagtc gatcgacgac ctgcacgaca tcgtgcggga catccgcact      1320
     gccatcttcg acctgcacgg tggttcgggc gggatcaccc aattccggcg gcggctgcac      1380
     gagatcgtgg ccgagaccac cgccgattcc ggattgcgca cgacggtgca catgtcgggg      1440
     ccgctgtccg tcatcgacgc cacgctcgcc gagcatgccg aggcggttct gcgtgaggcg      1500
     ttgagcaacg cggtccggca cgccggagcc gacacggtga cggtcagcat ctcggtctac      1560
     gacgacctcg ccatcgaggt cgcggacgac ggcaaggggt tcgagggaag cgtcctcacc      1620
     agcggactgg acaacctggc cgcccgggcg cgggaagtga acgggcactg cgccgtcgac      1680
     tcgaccctcg gcggtgggac cacgctccgg tggtccgctc cccttccgtg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page