(data stored in ACNUC7421 zone)

EMBL: AP011115.DNAJ

AP011115.DNAJ        Location/Qualifiers
FT   CDS_pept        139725..140915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ROP_01570"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48404"
FT                   /db_xref="GOA:C1ASF5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF5"
FT                   /protein_id="BAH48404.1"
FT                   /translation="MTQQEWIERDFYADLGVPSTASAEQIKRAYRTLARRLHPDANPDD
FT                   AAAGERFKAVSEAHAVLSDPATRAEYDRTRQLYRSGSFRQAGTRAGAAARSGGGMGGFD
FT                   LSDLFGSGSAAFTSGDAGFGDVFGDLFRRSGTRTTTASSRPRRGSDVEAQTRLPLRQAV
FT                   TGVVLPLQVSGPTVCTTCHGSGARPGTRPRRCPSCGGAGTLTRNQGGFGFSEPCDDCRG
FT                   TGMIVDHPCADCQGTGVGHRTRTINVRIPPGVTDGQRIRLPAHGEPGLRGAPAGDLYVT
FT                   VTVDPDPVFGRDGDDLTVTVPVGFGELALGTTISVPTLDGRVSVKIPAGTPSGRTFRLR
FT                   GRGVHRGGGPAGDLRVTVQVAVPTRLDRSAVDALRAYDKAEKATGFDPRAAWPGHR"
     gtgacgcagc aggagtggat cgagcgtgac ttctacgcag acctgggtgt gccctccacg        60
     gcgtcggcgg agcagatcaa acgcgcctac cgcacgctcg cccgccgatt gcacccggac       120
     gccaacccgg acgacgcggc ggccggagaa cgattcaagg cggtcagcga ggcgcacgcg       180
     gtgctctcgg atccggccac ccgcgccgag tacgaccgga cccggcagct gtaccggtcc       240
     gggtccttcc ggcaggccgg cacccgcgcc ggcgccgccg cccggtcggg cggcgggatg       300
     ggtgggttcg acctctccga cctgttcggg agcgggagtg ccgcgttcac ctccggcgac       360
     gccggattcg gagacgtgtt cggagatctg ttccggcgca gcggcacccg caccaccacc       420
     gcctcgtccc gcccccgccg gggcagcgac gtcgaggcgc agacccggct accgctgcgg       480
     caggccgtca ccggggtggt gctgcccctg caggtcagcg gacccacggt gtgcaccacc       540
     tgccacggca gcggcgcccg gcccggaacc cgtccaaggc ggtgcccctc gtgcggcggt       600
     gccgggaccc tgacccgcaa tcagggcggc ttcgggttca gcgaaccctg cgacgactgt       660
     cgcggcaccg ggatgatcgt cgaccacccg tgcgcggact gccagggaac tggggtcggg       720
     caccgcaccc gtaccatcaa cgtccgcatc ccacccgggg tcaccgacgg ccaacgcatt       780
     cggttgcccg cgcacggcga gcccggcctg cgcggggcac ccgccgggga tctgtacgtc       840
     accgtcacgg tggatccgga tccggtcttc ggccgcgacg gcgacgatct caccgtgacc       900
     gtgccggtcg ggttcggcga actcgccctc ggcaccacca tctcggtgcc caccctcgac       960
     gggcgggtca gcgtgaagat ccccgccggc accccgtccg ggcgcacctt ccggttacgt      1020
     ggtcgcggcg tgcaccgcgg cggcggcccc gcaggggatc tgcgggtgac cgtgcaggtc      1080
     gccgtgccga cccggctgga ccgcagcgcc gtcgacgccc tacgcgccta cgacaaggcc      1140
     gagaaggcca ccggattcga cccccgcgcc gcctggcccg gccaccgata g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page