(data stored in ACNUC7421 zone)

EMBL: AP011115.DNAK

AP011115.DNAK        Location/Qualifiers
FT   CDS_pept        136963..138834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ROP_01550"
FT                   /product="chaperone protein DnaK"
FT                   /note="protein synonym:Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48402"
FT                   /db_xref="GOA:C1ASF3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF3"
FT                   /protein_id="BAH48402.1"
FT                   /translation="MARAVGIDLGTTNSVVCVLEGGDPVVVANSEGSRTTPSVVAFAKS
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKREIGTDWTVAIDDKNYTAQEISARVLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLTVLRIINEPTAAALAYGLDKGGKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDDRIVRWLAEKFKASSGF
FT                   DLTKDKMALQRLREAAEKAKIELSSSHSTSINLPYITVDADKNPLFLDEQLSRSEFEKI
FT                   TSDLLGRTRAPFDSVIKDAKISVGDIDHVVLVGGSTRMPAVTNLVRELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLGGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIASHNKLLGSFELAGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENRIRIQEGSALSKEDIDRMIRDAEAHAAEDSRRREEAETRNQAESLV
FT                   YQTEKFIKDNDNKVPADVTDKVRSAIAQVQDALAGTDIAAIKTAMEKLGTESQALGQAI
FT                   YAAQAQQDGASAGGDGGPGAGAGASGDGHGADDVVDAEVVDEPREGR"
     atggcgcggg cggtcgggat cgatctgggt accacgaact cggtggtgtg cgtgctcgag        60
     ggcggtgacc cggtggtggt cgccaactcg gagggctccc gcaccacgcc gtcggtggtg       120
     gcattcgcga aaagtggcga ggtgctggtc ggccagcccg ccaagaatca ggccgtcacc       180
     aacgtggacc ggacggtgcg ctcggtcaaa cgcgagatcg gcaccgactg gacggtggcg       240
     atcgacgaca agaactacac cgcgcaggag atcagcgccc gggtgctgat gaaactcaag       300
     cgggacgcgg aatcgtatct gggcgaggac atcaccgacg cggtgatcac cgtccccgcc       360
     tacttcaacg acgcccaacg gcaggccacc aaggaagccg ggcagatcgc cgggctgacc       420
     gtgctgcgga tcatcaacga accgacggcc gcggcgttgg cgtacggcct ggacaagggc       480
     ggcaaggaac agaccatcct ggtcttcgac ctcggcggcg gaaccttcga cgtctccctg       540
     ctcgaaatcg gcgagggcgt cgtcgaggtc cgcgccacct ccggtgacaa ccacctcggc       600
     ggtgacgact gggacgaccg catcgtgcgg tggttggccg agaagttcaa ggcgtccagc       660
     ggattcgacc tgaccaagga caagatggcg ctgcagcggc tgcgggaggc cgcggagaag       720
     gcgaagatcg aactgtcctc gtcgcacagc acctcgatca acctgcccta catcaccgtc       780
     gacgcggaca agaacccgct gttcctcgac gagcagctct cgcgcagcga gttcgagaag       840
     atcacctccg acctcctcgg ccgcacccgg gccccgttcg actcggtgat caaggacgcg       900
     aagatctccg tgggcgacat cgaccacgtg gtgctggtcg gtggttccac ccggatgccc       960
     gcggtgacga atctggtgcg cgagctgacc ggcgggaagg aaccgaacaa gggtgtcaat      1020
     ccggacgagg tcgtcgccgt cggcgccgcc ctgcaggccg gtgtgctcgg cggtgaggtc      1080
     aaggacgtgc tgctcctcga cgtcaccccg ctctcgctcg gcatcgagac caagggcggg      1140
     gtgatgacca agctcatcga gcgcaacacc accatcccga ccaaaaggtc ggagaccttc      1200
     accaccgccg acgacaacca gccgtcggtg cagatccagg tgtatcaggg ggagcgcgag      1260
     atcgcctcgc acaacaagct gctcggcagc ttcgagctgg ccgggattcc gcccgccccg      1320
     cggggggtgc cgcagatcga ggtcaccttc gacatcgacg ccaacggcat cgtgcacgtg      1380
     accgccaagg acaagggcac cggcaaggag aaccggatcc gcatccagga aggctcggca      1440
     ctgtcgaagg aggacatcga ccggatgatc cgcgacgccg aggcacacgc cgccgaggac      1500
     agccggcgcc gggaggaagc cgaaacccgc aaccaggccg agtcgctggt atatcagacc      1560
     gagaaattca tcaaggacaa cgacaacaag gtacccgccg acgtcacaga caaggtgcgg      1620
     tccgcgatcg cacaggtgca ggacgcgttg gccggcaccg acatcgcggc gatcaagacg      1680
     gctatggaga agctgggtac cgaatcccag gccctcggcc aggccatcta cgccgcccaa      1740
     gcccagcagg acggagcgtc agccggtggc gacggcggcc ccggggccgg agccggagcg      1800
     tccggtgacg ggcacggcgc cgacgacgtc gtcgacgcgg aggtggtgga cgaaccccgg      1860
     gagggacggt ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page