(data stored in ACNUC7421 zone)

EMBL: AP011115.ENGA

AP011115.ENGA        Location/Qualifiers
FT   CDS_pept        complement(679733..681160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="ROP_06570"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48904"
FT                   /db_xref="GOA:C1ASX2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX2"
FT                   /protein_id="BAH48904.1"
FT                   /translation="MTEQFTTEFAGDGTWSEESDWEVLDLEDGGDGEAHVPVPTLAVVG
FT                   RPNVGKSTLVNRIIGRREAVVEDIPGVTRDRVSYEANWSGRRFMVQDTGGWEPDAKGLQ
FT                   QSVARQAELAMQTADAILLVVDAVVGATATDEAVAKVLRRSKTPVLLVANKVDDGRTES
FT                   EVAALWSLGLGQPHSVSATHGRGTGDLLDEVLAALPETPREGIPGGGPRRVALVGKPNV
FT                   GKSSLLNKLSGDERSVVHNVAGTTVDPVDSIVELGGRPWRFVDTAGLRKRVSHASGAEF
FT                   YASLRTKSAIEAAEVAILLIDASEPISEQDLRVLSMVADAGRALVIAFNKWDLVDEDRR
FT                   LQLDREVDRDLVRVPWAQRVNISAQTGRAVQKLVPALDTALESWDKRIPTGRLNTWLKE
FT                   VVAATPPPMRGGRLPRVMFATQAGTRPPTFVLFTTGFLEAGYRRFLERRLREEFNFDGS
FT                   PVRISVRVREKRERRSR"
     gtgaccgaac aattcaccac cgagttcgca ggcgacggca cctggagtga ggaatccgac        60
     tgggaggtcc tcgacctcga agacggcggc gacggggaag cccacgtccc ggttccgacc       120
     ctcgccgtgg tcgggcgccc gaacgtcggt aagtcgacgc tcgtgaaccg gatcatcggc       180
     cgccgtgagg ccgtcgtcga ggacattccg ggtgtgaccc gggaccgggt ctcgtacgag       240
     gcgaactgga gcggacgccg cttcatggtg caggacaccg gcggctggga acccgacgcc       300
     aagggcctgc agcagtccgt ggcccggcag gccgagctgg cgatgcagac cgcggacgcg       360
     atcctcctcg tggtcgacgc cgtcgtcggc gccaccgcga ccgacgaggc cgtggccaag       420
     gtgctgcgcc ggtccaagac gccggttctg ctggtggcca acaaggtgga cgacggccgc       480
     accgaatccg aggtggccgc actgtggtcg ctggggctcg gtcagccgca ctcggtgagc       540
     gcgacgcacg gtcgcggtac gggtgatctc ctcgacgagg tgctcgccgc cctgccggag       600
     accccgcggg aaggcatccc cggcggcgga ccgcggcgtg tggctctggt cgggaagccg       660
     aacgtcggga agtcgagcct gctgaacaag ctgtcgggcg acgagcgttc ggtggtccac       720
     aacgtcgcgg gcaccacagt cgatccggtc gactcgatcg tggaactcgg tggcagaccg       780
     tggcgtttcg tcgacaccgc cggtctgcgc aagcgggtca gccacgccag cggtgccgag       840
     ttctacgcgt cgctgcggac gaagagcgcc atcgaggcgg ccgaggtcgc gattctgctg       900
     atcgacgcgt ccgagccgat ctccgagcag gacctgcgtg tgctgagcat ggtcgccgac       960
     gccggccggg cccttgtcat cgcgttcaac aagtgggatc tcgtggacga ggaccggcgg      1020
     cttcagctcg accgtgaagt cgatcgggat ctggtgcggg tgccgtgggc gcagcgcgtg      1080
     aacatctcgg cgcagacggg acgcgcggtg cagaagctgg tgcccgcact cgacacggcg      1140
     ctggaatcgt gggacaagcg cattccgacg ggccggctca acacgtggct caaggaagtc      1200
     gtcgccgcga cgccgccgcc gatgcgcggt ggcaggttgc cgcgcgtgat gttcgccacg      1260
     caggccggaa cgcgtccccc gacgttcgtg ctgttcacga ccgggttcct cgaggcgggg      1320
     taccgccggt tcctggagcg gcgtctgcgt gaggagttca atttcgacgg cagtcccgtc      1380
     cgcatctcgg tgcgggtgcg cgaaaagcgt gagcgacgga gtcgttga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page