(data stored in ACNUC7421 zone)

EMBL: AP011115.GARA

AP011115.GARA        Location/Qualifiers
FT   CDS_pept        complement(667116..667616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garA"
FT                   /locus_tag="ROP_06410"
FT                   /product="putative signal transduction protein GarA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48888"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV6"
FT                   /protein_id="BAH48888.1"
FT                   /translation="MSENGNDAVYGETPAETTSVFRADFLNELDNSSATQAPEAPVSGV
FT                   EGLPAGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQEDDE
FT                   FQVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPRTTAGGSQIGETSAGA
FT                   GSQ"
     gtgagcgaga acggcaacga cgcggtctat ggggagacgc cggcggaaac cacgtcggtc        60
     ttccgcgcgg actttctcaa tgagctcgac aactcctcgg caacccaggc tccggaggcc       120
     ccggtgtcgg gtgtggaggg actgcccgcg ggctctgctc tgctcgtcgt caagcgtgga       180
     ccgaacgcag ggtcgcgctt cctgctcgac cagccgacga cgtccgcagg gcggcatccc       240
     gacagcgaca tcttcctcga cgacgtgacg gtcagccgtc gtcatgcgga attccgccag       300
     gaggacgacg agttccaggt ggtcgacgtg ggcagcctca acggtaccta cgtcaaccgc       360
     gagcccgtcg actcggcagt cctcgcgaac ggcgacgagg tgcagatcgg caagttccgg       420
     ctggtcttcc tgaccggacc ccggaccacg gccggtggct cgcagatcgg tgagacgtca       480
     gctggtgcgg gtagccaatg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page