(data stored in ACNUC7421 zone)

EMBL: AP011115.GCVP

AP011115.GCVP        Location/Qualifiers
FT   CDS_pept        complement(661646..664498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="ROP_06370"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="protein synonym:glycine cleavage system P-protein"
FT                   /note="protein synonym:glycine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48884"
FT                   /db_xref="GOA:C1ASV2"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV2"
FT                   /protein_id="BAH48884.1"
FT                   /translation="MIDAGSRTFADRHVGPNAAELAHILELVGADSLDDLASKAVPAVI
FT                   LDGVTGGIADGLDALPAPVSEHEALAELSALAAQNTVATSMIGLGYYDTLTPPVLIRNI
FT                   IENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGMEVANSSMLDEATAAAEAMTLL
FT                   RRASKSKSPRFVVDADLFPQTLAVVETRAEPLGIEIVVADLSAGLPDGDFFGVLGQMPG
FT                   ASGRIADYTDVIAAAHERGALVAVGADLLALTLLTPPGEIGADACFGTTQRFGVPMGFG
FT                   GPHAGYLAVHTKHARQLPGRLVGVSVDADGDKAYRLALQTREQHIRREKATSNICTAQV
FT                   LLAILAAMYASYHGAEGLKAIALRVAATAHSLAAALRGTGATVVHEHFFDTILVRVDGR
FT                   AADVVAKAKDAGINLRLVDADHVAVACDEATTDDDVARVLAAFGGDGPVAREAGTSVPE
FT                   SQLRGSDYLQHEAFTRYRTETAMLRYLRALSDKDIALDRSMIPLGSCTMKLNATAEMEA
FT                   ITWPAFAGLHPFAPTGDTPGILRIIKDLENWLVAVTGYDAVSLQPNAGSQGEYAGLLAI
FT                   RNYHLSRGDDHRDTCLIPSSAHGTNAASAVMAGMRVEVVACRPNGDVDLDDLRAKIADH
FT                   AERLAAIMITYPSTHGVYEHEIADICAAVHDAGGQVYVDGANLNALVGLARPGRFGGDV
FT                   SHLNLHKTFCIPHGGGGPGVGPIGVRSHLTPFLPGHPLAPELGTAGPISAAPYGSASIL
FT                   PITWAYIRMMGAVGLRRASLTAIASANYIARRLDEYFPVLYTGEGGMVAHECILDLRPI
FT                   TKDTGVTVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESENLEEIDAFCEAMIAIRAE
FT                   IDRVGSGEWTVDDNPLRGAPHTAGCLAAEWNHPYTRETAVFPRGKARPKVWPAVRRIDG
FT                   AHGDRNLVCSCPPISAFEGA"
     gtgatcgacg ctggaagccg tacattcgcc gatcgtcatg tcggcccgaa cgctgcggaa        60
     ctcgcgcata ttctcgaact ggtcggagcc gactcgctcg acgacctcgc gtcgaaggcc       120
     gttcccgccg tcatcctgga cggggtcacg ggcggcatcg ccgacggcct cgacgccctg       180
     cccgcaccgg tctccgagca cgaggcgctc gccgaactgt cggcgctcgc cgcgcagaac       240
     accgtggcga cgtccatgat cgggctcggc tactacgaca ccctcacccc gccggtgctg       300
     attcggaaca tcatcgagaa cccggcctgg tacaccgcgt acacgccgta ccagcccgag       360
     atcagccagg gccgcctcga agccctcctc aacttccaga cgatggtcgc cgacctgacc       420
     ggcatggagg tcgccaactc gtcgatgctc gacgaggcca ccgccgccgc cgaggcgatg       480
     acgctgctgc gccgcgcgag caagagcaag tccccgcggt tcgtcgtcga cgccgacctg       540
     ttcccgcaga cgctggccgt cgtcgagacg cgggccgagc cgctcggcat cgagatcgtg       600
     gtggccgacc tgtccgccgg tctgccggac ggcgacttct tcggcgtcct cggacagatg       660
     cccggtgcgt ccggccgcat cgccgactac accgacgtga tcgcggcagc ccacgagcgc       720
     ggcgcactgg tcgcggtcgg ggcggacctg ctggcgctca ctctcctcac cccgcccggc       780
     gagatcggtg ccgacgcctg cttcggcacc acccaacggt tcggtgtccc catgggcttc       840
     ggtggcccgc acgccggata cctggccgtg cacaccaaac atgcacgtca gctccccggc       900
     cggctggtgg gcgtctccgt agacgccgac ggcgacaagg cctaccggct ggcgctgcag       960
     acccgggaac agcacattcg ccgtgagaag gcgacgtcga acatctgcac cgcgcaggtg      1020
     ctcctcgcga tcctcgcggc catgtacgcc agctaccacg gtgccgaggg cctgaaggcg      1080
     atcgccctgc gcgtggctgc cacggcacac tctctggcgg ccgcactccg ggggaccggg      1140
     gccaccgtcg tgcacgagca cttcttcgac acgattctcg tgcgtgtcga cgggcgggcg      1200
     gccgacgtgg tggcgaaggc gaaggacgcc ggcatcaacc tgcggctcgt cgacgccgat      1260
     cacgtcgccg tcgcctgcga cgaggccacc accgacgacg acgtcgcccg cgtgctggca      1320
     gcattcggcg gcgacggccc cgtggcccgg gaggcgggca cgtccgtgcc ggagtcgcag      1380
     ctccgcggat ccgactacct gcagcacgag gcgttcaccc ggtaccgtac cgagacggcg      1440
     atgctgcgct acctgcgggc gttgtccgac aaggacatcg cactcgaccg cagcatgatc      1500
     ccgctgggct cctgcacgat gaagctcaat gcgaccgccg agatggaagc gatcacctgg      1560
     cccgcgttcg ccggactgca cccgttcgcg cccacagggg acacgccggg aattctgcgc      1620
     atcatcaagg acctcgagaa ctggctggtg gccgtcaccg gctacgacgc ggtcagcctg      1680
     cagccgaacg ccggtagcca gggcgagtac gccgggctgc tcgcgatccg caactaccac      1740
     ctcagccgcg gcgacgatca ccgcgacacc tgcctcatcc cgtcgagcgc ccacggcacc      1800
     aacgccgcct cggcggtcat ggccgggatg cgcgtcgagg tcgtcgcgtg ccgccccaac      1860
     ggtgacgtgg acctcgacga cctgcgggcg aagatcgccg accatgccga gcgcctcgcg      1920
     gcgatcatga tcacctaccc gtccacccac ggggtgtacg agcatgagat cgccgacatc      1980
     tgcgccgccg tccacgacgc gggcggccag gtgtacgtcg acggcgccaa cctcaacgcc      2040
     ctggtcggcc tggcccggcc gggacggttc ggcggcgacg tcagccacct caatctgcac      2100
     aagacgttct gcatcccgca cggcggcggc ggccccggtg tcggaccgat cggcgtgcgg      2160
     tcgcacctca ccccgttcct gcccggacat ccgctcgcac ccgaactcgg caccgccgga      2220
     ccgatctccg cggccccgta cggcagcgcg tcgattctgc ccatcacgtg ggcgtacatc      2280
     cggatgatgg gcgccgtcgg actgcgccgc gccagcctga ccgcgatcgc gtcggccaac      2340
     tacatcgcac gccgcctgga cgagtacttc cccgtcctct acaccggcga gggcggcatg      2400
     gtggcccacg agtgcatcct cgacctccgg ccgatcacca aggacaccgg tgtgaccgtg      2460
     gacgacgtcg caaagcgcct cgccgactac ggttttcacg ctccgacgat gagcttcccg      2520
     gtggcgggca cgctgatggt ggagcccacc gagagcgaga acctcgaaga gatcgacgcc      2580
     ttctgcgagg cgatgatcgc gatccgtgcc gagatcgacc gcgtcggctc gggggagtgg      2640
     acggtggacg acaacccgct gcgcggtgcc ccgcacacgg ccggctgcct ggcggcggag      2700
     tggaaccacc cctacacccg cgagaccgcg gtgttccccc gcggcaaggc ccggccgaag      2760
     gtgtggcccg cggtgcggcg catcgacggc gcgcacggcg accgcaacct cgtgtgctcc      2820
     tgcccgccga tctccgcgtt cgaaggcgcc tga                                   2853
//

If you have problems or comments...

PBIL Back to PBIL home page