(data stored in ACNUC7421 zone)

EMBL: AP011115.GLTB

AP011115.GLTB        Location/Qualifiers
FT   CDS_pept        complement(769627..774210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ROP_07350"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48982"
FT                   /db_xref="GOA:C1AT50"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT50"
FT                   /protein_id="BAH48982.1"
FT                   /translation="MLFSQLPGPQGLYDPDQEVDSCGVAMVADLHGRHSHAIVADGLLA
FT                   LENLEHRGAAGSEPNSGDGAGILLQLPTEFFGALAPFDLPAPLDDGSSTYAAGICFLPQ
FT                   DPQARAAAQRRVSDLADEEGLQILGWRPVPVDPDGADVGSTARACAPHMSQLFVAAPAV
FT                   GGIRPGGLALDRLVYPLRKRAEQVTPDIESEGSGVYFPSLSSRTIVYKGMLTTSQLARY
FT                   FPDLRDRRMASAIAIVHSRFSTNTFPSWPLAHPFRFVAHNGEINTVRGNRNRMRAREAL
FT                   LSSAVIPGDLSRLYPICTPDASDSASFDEVLELLHLAGRSVPHVVMMMVPEAWENDASM
FT                   CPDRRAFYQFHASLMEAWDGPACVTFTDGTVVGAVLDRNGLRPGRWWQTVDGRVVLASE
FT                   SGVLDVPQAEVVAKGRLEPGQMFLVDTSEGRIVPDEEIKMRLAAERPYAEWLYAGLLEL
FT                   KTLPDRPHAQHNHESVVRRQVAFGYTEEDLRILLAPMATSGGEPLGSMGTDTPIAVMSQ
FT                   RSRLLYDYFVELFAQVTNPPLDAIREEVVTSLSRVMGPEQNLLEPTAASCRQIVLPWPV
FT                   LDNEELNKIIHVNADGNHPGLAAAVLRALYDVERGGAGMAEAIEELRAQASAAIADGYR
FT                   TLVISDRDSDHTRAPIPSLLAVAAVHHHLVRTKERTKVALVVESGDAREVHHLALLIGY
FT                   GAAAVNPYLAMESIEDLVSEGELTGVEHTIAVRNYLTALGKGVLKVMSKMGISTVGSYT
FT                   AAQVFEAIGLDRDLVHEYFTGTVSKLGGAGLDEIAREVTVRHRQAYPDNPAEFAHRRLE
FT                   DGGEYQFRRDGELHLFTPETVFLLQHATRTGQHEVFAKYSEEVNRLAEAGGALRGLFTF
FT                   REGVRPPVPLDEVEPAERIVTRFNTGAMSYGSISAEAHETMAVAMNNLGGRSNSGEGGE
FT                   NVDRLYDPSRRSAVKQVASGRFGVTSDYLINASDIQIKMAQGAKPGEGGQLPAYKVYPW
FT                   VAETRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANDRARVHVKLVSSVGVGTVAA
FT                   GVSKAHADVVLISGNDGGTGATPLTSMKHAGAPWEIGLADAQQTLVLNGLRDRITIQCD
FT                   GGMRTGRDVVVAALLGAEEFGFSTAPLIVAGCIMMRVCHLDTCPVGVATQNPELRKRYT
FT                   GKPEFVEEFFRFVAEDVRRYLAELGFRSIDEAVGHADVLETAQGIAHWKNRGLDLTPIF
FT                   AVPAGPDGEPLPQRRRDRDQDHGLDRALDRTLIQLAEGALEDAHAVEIEMPVRNVNRTV
FT                   GTLLGAEVTRRYGAAGLPDDTIRLTFTGSAGQSLGAFLPPGITVDLTGDANDYVGKGLS
FT                   GGRIVVRPADDVLFVPETQVIAGNTLLYGATSGEVYLRGRVGERFSVRNSGASAVVEGV
FT                   GDHACEYMTGGRVVILGPTGRNLAAGMSGGIAYVLDLDPDDVNPAMVKLMQPDPDDLDW
FT                   LCGAVTRHHRWTGSAVAASVLADWPRRSALFTKVMPVDYQRVLDATRMAKAEGLDVDTA
FT                   IMEAARG"
     gtgctgttct ctcagttgcc cggtcctcag ggcttgtacg acccggacca ggaagtcgat        60
     tcctgcggtg tcgccatggt cgcggacctg cacggccgcc actcccatgc catcgtcgcc       120
     gacgggctcc tcgctctcga gaatctcgag caccgggggg cggcgggatc agaaccgaac       180
     agcggcgacg gcgccggcat cctgctccag ctccccaccg aattcttcgg ggctctcgcc       240
     ccgttcgacc ttcccgcgcc gctggacgac ggcagcagca cgtacgcggc gggcatctgc       300
     ttccttccgc aggacccgca ggcgcgggcg gccgcgcagc gacgcgtgtc cgacctcgcg       360
     gacgaggagg gactccagat cctcggctgg cgtccggtgc ccgtcgatcc ggacggcgcg       420
     gacgtcggct cgacggcgcg cgcctgcgca ccgcacatga gccagttgtt cgtcgccgca       480
     cccgccgtgg gcgggatccg gcccggcggg ctcgccctcg accgcctcgt ctacccactg       540
     cgcaagcggg ccgaacaggt caccccggac atcgagtcgg agggcagtgg cgtctacttc       600
     ccgtcgctgt cgagccggac gatcgtctac aagggaatgc tcaccacgtc ccagttggcg       660
     cggtacttcc cggacctgcg cgaccggcgg atggcgagtg cgatcgcgat cgtgcacagc       720
     cggttctcga ccaacacgtt cccgtcctgg ccgctcgcac acccgttccg gttcgtcgcg       780
     cacaacgggg agatcaacac ggtccgcggc aaccgcaacc gcatgcgggc ccgcgaggcg       840
     ctgctgtcga gtgcggtgat cccgggcgac ctgagcaggt tgtacccgat ctgtactccc       900
     gacgcgtcgg attcggcgtc attcgacgag gtcctcgaac tgctgcacct cgcaggccgc       960
     agcgtgccgc acgtggtgat gatgatggtg ccggaggcgt gggagaacga cgcgtcgatg      1020
     tgcccggacc ggcgggcgtt ctaccagttc cacgcgtcgc tgatggaggc gtgggacggt      1080
     cccgcgtgtg tgacgttcac cgacgggacc gtggtcggcg ccgtgctgga ccgcaacggc      1140
     ctgcgcccgg gacgctggtg gcagaccgtc gacgggcggg tggtcctcgc gagcgagagc      1200
     ggggtcctcg acgtcccaca ggcggaggtc gtggccaagg gccgcctcga gccgggacag      1260
     atgttcctgg tggacacgtc cgagggccgc atcgtgccgg acgaggagat caagatgcgg      1320
     ctcgcggcgg agcggccgta cgccgagtgg ctgtacgccg ggctgctcga actgaagacg      1380
     ttgccggacc ggccgcacgc gcagcacaac cacgagtcgg tggtgcggcg gcaggtggcg      1440
     ttcgggtaca ccgaggagga tctgcgcatc ctgctggccc cgatggccac gtccggcggc      1500
     gagccacttg gttcgatggg gacggacacg ccgatcgctg tcatgtcgca gcggtcgcgg      1560
     ctgctctacg actatttcgt cgaactgttc gcgcaggtca cgaacccgcc gctcgacgcg      1620
     atccgcgaag aggtcgtgac gtcgctgtcg cgggtcatgg gcccggagca gaatctgctc      1680
     gagccgaccg cggcgtcgtg caggcagatc gtgctgccgt ggccggtgct cgacaacgaa      1740
     gagctgaaca agatcatcca cgtgaacgcg gacggcaacc atcccgggct ggccgcggcg      1800
     gtgctgcgcg cgctgtacga cgtcgagcgc ggcggtgcgg ggatggccga ggcgatcgag      1860
     gagttgcggg cgcaggcgag cgccgcgatc gcggacggct accggacgct ggtgatctcg      1920
     gaccgcgatt ccgaccacac gcgggcgccg atcccgtctc tgctcgcggt ggccgcggtg      1980
     caccatcacc tggtgcggac gaaggagcgc accaaggtgg cgctggtcgt cgaatccggg      2040
     gacgcccgcg aggtccacca cctggcgttg ctcatcgggt acggcgctgc cgccgtcaac      2100
     ccctacctcg cgatggagtc gatcgaagac ctcgtgtcgg agggcgagct caccggagtc      2160
     gagcacacga tcgccgtccg gaactacctc accgcgctcg gcaagggcgt gctcaaggtg      2220
     atgtcgaaga tgggcatctc caccgtcggc tcgtacaccg cggcgcaggt gttcgaggcg      2280
     atcggcctgg accgcgacct cgtccacgag tacttcacgg gcacggtcag caaactgggc      2340
     ggcgcgggtc tcgacgagat cgcccgcgag gtcaccgtcc gacaccggca ggcgtacccg      2400
     gacaatccgg ccgagttcgc ccaccggcgg ctcgaggacg gcggcgagta ccagttccgc      2460
     cgcgacggcg aactgcacct gttcaccccg gagacggtgt tcctgctgca gcacgccacc      2520
     cgcaccggtc agcacgaggt gttcgccaag tacagcgagg aggtgaaccg gctcgccgag      2580
     gccggtggcg ccctgcgcgg actgttcacg ttccgcgagg gtgtgcggcc gcccgtgccg      2640
     ctggacgagg tggaaccggc cgagcggatc gtcacccggt tcaacacggg tgcgatgagc      2700
     tacggctcca tctccgccga ggcccacgag acgatggccg tcgcgatgaa caatctcggc      2760
     ggacgctcca actccggaga aggcggcgag aacgtcgacc ggctctacga tccgtcacgg      2820
     cgcagcgccg tcaaacaggt ggcgagcggg cggttcggtg tcaccagcga ctacctgatc      2880
     aacgccagcg acatccagat caagatggcg cagggcgcca agcccggcga gggcgggcag      2940
     ctgccggcct acaaggtgta cccgtgggtc gcggagaccc ggcactcgac gccgggggtc      3000
     gggctgatct cgccgccccc gcaccacgac atctactcga tcgaggatct cgcccagctg      3060
     atccacgacc tgaagaacgc caacgaccgg gcccgggtcc acgtgaagct ggtcagctcg      3120
     gtgggggtgg gaaccgtcgc cgccggcgtc agcaaggcgc acgccgacgt ggtcctcatc      3180
     tccggcaacg acggcggaac cggcgccacc ccgctgacgt cgatgaagca tgccggggcg      3240
     ccgtgggaga tcgggctggc cgacgcccag cagacgctcg tgctcaacgg tctccgcgac      3300
     cgcatcacca tccagtgcga cggcgggatg cgcaccggac gggacgtcgt ggtcgcggcg      3360
     ctgctgggtg cggaggaatt cgggttctcc acggccccgc tgatcgtggc gggctgcatc      3420
     atgatgcggg tgtgccacct cgacacctgc ccggtcggtg tcgccaccca gaacccggag      3480
     ctgcgcaagc ggtacaccgg caagccggag ttcgtggagg agttcttccg gttcgtcgcc      3540
     gaggacgtgc gccggtatct cgcggaactc gggttccgca gcatcgacga ggccgtgggt      3600
     cacgccgacg ttctcgagac cgcgcagggg atcgcccact ggaagaaccg cggactcgat      3660
     ctcaccccga tcttcgccgt gcccgccggg ccggacgggg agccgttgcc gcagcggcgc      3720
     cgggaccgcg accaggacca cggactggac cgggcactgg accgcacgct gatccagctg      3780
     gcggagggcg ccctcgagga tgcccacgcc gtggagatcg agatgccggt gcgcaacgtc      3840
     aaccggaccg tcggcacgct gctcggcgcg gaggtcaccc gccgctacgg cgccgccggg      3900
     ctgccggacg acacgatccg gctcacgttc accggttcgg cggggcagtc gctgggcgcg      3960
     ttcctgccgc cgggcatcac cgtcgacctg accggggacg ccaacgacta cgtcggcaag      4020
     gggttgtcgg gtgggcggat cgtggtccgt cccgccgacg acgtcctgtt cgtcccggag      4080
     acgcaggtga tcgcggggaa caccctgctc tacggcgcca cctcggggga ggtctacctc      4140
     cgcggacgcg tcggggaacg cttctcggtg cgcaattccg gtgcgtcggc cgtcgtggag      4200
     ggtgtcggcg accacgcctg cgaatacatg acgggcgggc gggtcgtgat cctcggaccg      4260
     accggacgga acctggcggc cggcatgtcc ggtggcatcg cgtacgtcct cgacctggac      4320
     ccggacgacg tgaacccggc gatggtgaag ctgatgcaac ccgacccgga cgatctggac      4380
     tggttgtgcg gcgccgtcac ccggcaccac cggtggaccg gctccgcggt ggcggcgtcg      4440
     gtgctcgccg actggccccg gcggtccgcg ctgttcacca aggtgatgcc ggtggactac      4500
     cagcgggtgc tggacgcgac ccggatggcg aaggcggagg gactggacgt cgacactgcg      4560
     atcatggagg cggcacgtgg ctga                                             4584
//

If you have problems or comments...

PBIL Back to PBIL home page