(data stored in ACNUC7421 zone)

EMBL: AP011115.GLTD

AP011115.GLTD        Location/Qualifiers
FT   CDS_pept        complement(768132..769634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ROP_07340"
FT                   /product="glutamate synthase small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48981"
FT                   /db_xref="GOA:C1AT49"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT49"
FT                   /protein_id="BAH48981.1"
FT                   /translation="MADPQGFLHIVKKEAPKRPIAERIHDWNEVYAPQSSAERAAEVSE
FT                   QAARCMDCGIPFCHSGSAGCPLGNLIPEWNDLVRRGRWSAASERLHATNNFPEFTGRVC
FT                   PAPCESACVLSLADTHTTGSVTIKRIEQAIADVAWDSGTVVPKPPMIATGRKVAVVGSG
FT                   PAGLAAAQQLTRAGHDVTVYERDDRLGGLLRYGIPEFKMEKAILDQRLMQMRAEGTHFV
FT                   TDCEVGVDLTVEQMRENFDAVVLAIGALRARDNTTVEGRELNGIHLAMEHLVTSNKECE
FT                   GDGPATITAKGKHVVIIGGGDTGADCLGTAHRQGALSVTQLDYNPELPTERDEAATPWP
FT                   AWPMVLRTSPAHAEGGVRRYQVAVQRFLGDANGNVRSMVLAEVEVAREDGKRIITPVGE
FT                   EIELPCELALFAIGFEGVDLGPLLDDYGLSPTRRGALSCGPDWQTTAPGVFVCGDAHRG
FT                   ASLVVWAIAEGRSAAHAVDVYLTGASDLPSPVHPTALPLAVV"
     gtggctgatc cccagggctt tctgcacatc gtgaagaagg aggcgcccaa gcgtccgatc        60
     gcggagcgga tacacgactg gaacgaggtg tacgcgccgc agagttccgc ggagcgggcc       120
     gccgaggtgt ccgagcaggc cgcgcggtgc atggactgcg gaatcccgtt ctgccactcg       180
     ggaagtgcgg gctgcccgct gggcaatctg atcccggagt ggaacgatct cgtgcggcgc       240
     ggccgctggt cggcggccag tgagcggctg cacgccacca acaacttccc ggagttcacg       300
     ggccgggtgt gcccggcgcc gtgcgagtcg gcgtgtgtgc tctcactcgc cgacacgcac       360
     acgacgggca gcgtcacgat caagcggatc gagcaggcga tcgcggacgt cgcgtgggac       420
     tcgggcacgg tggtacccaa gccgccgatg atcgccacgg gccgcaaggt cgcggtggtc       480
     gggtccgggc ctgccggcct ggccgcggct cagcagctga cccgggcagg gcacgacgtc       540
     accgtctacg agcgcgacga ccggctcggg ggactgctgc ggtacggcat cccggaattc       600
     aagatggaga aagcgatcct cgatcagcgc ctgatgcaga tgcgtgccga gggaacccac       660
     ttcgtcaccg actgcgaggt cggcgtcgac ctcaccgtgg agcagatgcg cgagaacttc       720
     gacgcggtgg tgctcgcgat cggcgcgctg cgggcccgcg acaacaccac cgtcgagggc       780
     cgcgagctga acgggatcca cctcgcgatg gaacacctcg tcacctccaa caaggaatgt       840
     gagggcgacg gtcccgcgac gatcaccgcc aagggcaagc acgtcgtcat catcggcggc       900
     ggcgacaccg gcgccgactg cctcgggacg gcgcaccgcc agggcgcgct gtcggtgacc       960
     caactggact acaacccgga gttgccgacg gagcgggacg aggccgcgac gccgtggccc      1020
     gcgtggccga tggtgctgcg cacgtcgccc gcgcacgccg agggcggtgt ccgccggtac      1080
     caggtcgcgg tgcagcggtt cctcggcgac gcgaacggga atgtccggtc catggtgctc      1140
     gccgaggtcg aggtcgcccg cgaggacggc aaacgcatca tcacgccggt cggcgaggag      1200
     atcgaattac catgcgagct ggcgcttttc gcgatcgggt tcgagggcgt cgatctcggt      1260
     ccgctgctcg acgactacgg gttgtcgccg acccgtcgcg gggcgctctc ctgcgggccg      1320
     gactggcaga ccaccgcacc cggggtcttc gtgtgcgggg acgcgcaccg cggcgcgtcg      1380
     ctcgtggtgt gggcgatcgc ggagggccgg tcggccgcgc acgccgtcga cgtgtacctg      1440
     accggggcgt cggacctccc gtcgccggtg catccgacgg cgcttccgct ggcagtcgtc      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page