(data stored in ACNUC7421 zone)

EMBL: AP011115.GRPE

AP011115.GRPE        Location/Qualifiers
FT   CDS_pept        138841..139632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="ROP_01560"
FT                   /product="GrpE protein"
FT                   /note="protein synonym:nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48403"
FT                   /db_xref="GOA:C1ASF4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF4"
FT                   /protein_id="BAH48403.1"
FT                   /translation="MNTPYDEQQRSGTAGRGRGNGRQPPREPIAITDRRRIDPVTGRVR
FT                   QDTPGSHSPQDRGASTLSGKASPGEKAGTSSLDTGAARPEPRQVDSDRVAELTADLQRL
FT                   QAEYANYRRRVERDRAAAAENAKASVVAEFLGVLDDLDWAREHGDTAREPRHSLSRKIR
FT                   TILARMGVAAFGERGDRFDPTLHEAASHDGHGTDLVVDTVLRRGYTFGVHTVLRTALVT
FT                   VIDRDRYENTSNPGPPADTDARPESGGAGDPGDDPNPYRCG"
     atgaacacac catacgacga gcagcaacgt tccggaacgg ccggtcgcgg ccggggcaac        60
     ggtcggcagc cgccgcgcga gccgatcgcg atcaccgacc ggcgccgcat cgacccggtc       120
     accggccggg tccggcagga cacacccgga tcccattccc cgcaggatcg aggggcatcg       180
     acgctgagcg ggaaggcgtc cccgggcgag aaggcaggca catcgtcctt ggacacgggt       240
     gccgcgcggc cggagccccg gcaggtcgac tcggaccggg tggcggagtt gacggccgat       300
     ctacagcgcc tgcaggccga gtacgccaac taccggcgcc gggtcgagcg ggaccgggcg       360
     gcggccgcgg agaacgcgaa agcgtcggtc gtcgccgagt tcctcggtgt tctcgacgac       420
     ctggactggg cccgcgagca cggtgacacc gcccgggagc cgcggcacag cctgtctcgg       480
     aagatccgga ccatcctggc ccggatgggg gtcgcggcgt tcggggagcg cggggaccgc       540
     ttcgatccca ccctgcacga ggccgccagc cacgacggtc acggcaccga cctggtggtg       600
     gacaccgtgc tgcgccgcgg ctacaccttc ggcgtgcaca cggtgctgcg gaccgcgttg       660
     gtcaccgtga tcgaccgcga ccggtacgag aacaccagca accccggccc cccggcggac       720
     accgacgcgc ggccggagtc cggcggggcc ggggacccgg gtgacgaccc gaatccctac       780
     cgctgcggat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page