(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPA

AP011115.GVPA        Location/Qualifiers
FT   CDS_pept        346434..346844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpA"
FT                   /locus_tag="ROP_03300"
FT                   /product="putative gas vesicle structural protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48577"
FT                   /db_xref="GOA:C1ARA0"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA0"
FT                   /protein_id="BAH48577.1"
FT                   /translation="MTAIQPAGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSLV
FT                   GIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGSVTEGGAKSKTKGAL
FT                   EAAGDKLGDILGGGQEEPERERVSRKSSRGDK"
     atgacggcaa tacaacccgc gggcggcggc ggtggagtca gcggcggccc aagctccagt        60
     agcctcgccg acgtcatcga caccatcctc gacaaaggcc tcgtcatcga tgcctacgtg       120
     cgggtgtcat tggtcggtat cgaactgctg acgatcgacg cgcgcgtcgt cgtcgccagt       180
     gtcgacacct acctgcggtt cgcggaggca gtgaaccggc tggagatcgg cagtggggag       240
     ccgaagggcc tgacggacct ggtcggatcg gtcaccgagg gcggtgccaa atcgaagacc       300
     aagggcgcgc tcgaggccgc gggtgacaaa ctcggcgaca tcctcggcgg cggacaggaa       360
     gaacctgagc gcgaacgggt ttcgcgcaag tccagtcgag gggacaagtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page