(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPJ

AP011115.GVPJ        Location/Qualifiers
FT   CDS_pept        348181..348588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpJ"
FT                   /locus_tag="ROP_03340"
FT                   /product="putative gas vesicle synthesis protein GvpJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48581"
FT                   /db_xref="GOA:C1ARA4"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA4"
FT                   /protein_id="BAH48581.1"
FT                   /translation="MTVVGGGASNLPQSSGGGFGGGHQSTNLGEILERVLDKGLVIAGD
FT                   IQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERIAE
FT                   LESDRSVRPAVEDADTVEVEASRQERDDDRR"
     atgaccgtcg tcggcggcgg tgcgagcaac ctcccgcaga gttcgggcgg cggattcggc        60
     ggcgggcacc agtcgacgaa tctcggcgag attctcgagc gggtgctcga caagggtctc       120
     gtgatcgcgg gcgacatcca ggtcaacctg ctcgacatcg aattgctgac catcaaggtg       180
     cgcctggtga tcgcgtcgct ggaaaccgcg aaggaagtgg gcatcgactg gtgggagcac       240
     gacccctggc tgaccggcaa gaacagcgac gtcgaactgg agaatcggaa gttgcgggag       300
     cggatcgccg aactcgagtc cgacaggtcg gttcgccccg ccgtcgagga cgccgacacg       360
     gtcgaggtgg aggcgagccg tcaggagcgg gacgatgacc gcagatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page